Dataset for protein Bmf of organism Colobus angolensis palliatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5KGR6_BMF-01      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A2K5KGR6_BMF-02      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
                       **************************************************

A0A2K5KGR6_BMF-01      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPA
A0A2K5KGR6_BMF-02      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
                       ***********************************************. *

A0A2K5KGR6_BMF-01      EPKSRVVADPPL-----PAQPCFEWRREQERGGPQVRLGCPLHMGHQEHR
A0A2K5KGR6_BMF-02      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIAR-KLQCIADQFHRLHV
                         .  : *. *         *  :*..  *   .. .* *     *. * 

A0A2K5KGR6_BMF-01      QEGHRAGLTLCLVKLFFCCYFAF------------
A0A2K5KGR6_BMF-02      QQHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR
                       *: :.    :    *:*   :*:            

© 1998-2018