Dataset for protein Bad of organism Colobus angolensis palliatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5HKW9_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
A0A2K5HKW9_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
                       **************************************************

A0A2K5HKW9_BAD-01      QQEQATSSSHHGGAG-AVETRSRHSSHPAG---TEEDEGME----EEPSP
A0A2K5HKW9_BAD-02      QQEQATSSSHHGGRAWYSPSESEDSENPSARMLTEASAGMSAPATDSEAQ
                       ************* .    : *  *.:*:.   ** . **.    :. : 

A0A2K5HKW9_BAD-01      FRGRSRSAPPNLW----------AAQRYGRELRRMSDEFVDSFKGLPRPK
A0A2K5HKW9_BAD-02      HAENVKLEALGLWRPGVATAPTPRGRRRTKGWRRSPAPF--GAARAPRPL
                       .  . .  . .**           ..*  .  ** .  *  .    *** 

A0A2K5HKW9_BAD-01      SAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
A0A2K5HKW9_BAD-02      TSGQHSDMAASSGG---------------------
                       ::*  ::*  **.                      

© 1998-2018