Dataset for protein classical BH3-containing proteins of organism Chlorocebus sabaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0D9S2H2_BBC3-01      QAPGSAMARARQEGSSPEPV-EGLARDGPRPFPLGRLVPSAVSCGLCEPG
A0A0D9R4R5_BMF-01       MEPSRCVEELEDDVFQPEDG-----EPGAQP------GSSLSADLFAQSL
A0A0D9QZY8_BIK-01       -------------------------MSGVRP------IS---RHILMESL
A0A0D9R491_BAD-01       MFQIPEFEPSEQEDSSSAERGLGPSPAGNRP------SDSGKHHHQAPGL
A0A0D9S003_PMAIP1-      -------------------MPGKKARKNAQP-------SPTRAQAELEVE
A0A0D9RWE0_BCL2L11      --------------------------MAKQP-------SDVSSECDREGR
A0A0D9SC73_HRK-01       -------------------MCPCPLHRGRGP-------PAV---CACSAG
                                                      *                   

A0A0D9S2H2_BBC3-01      LAAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRP--RGPRPD
A0A0D9R4R5_BMF-01       LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVT
A0A0D9QZY8_BIK-01       LYEQLLEPLTMEVLGVTDPEEDLDPMEDFDP-------------LECMED
A0A0D9R491_BAD-01       LWD------------ASHQQEQPTSSSHHGG-------------AGAVET
A0A0D9S003_PMAIP1-      -----------CATQLRRFGDKLNFRQ-----------------------
A0A0D9RWE0_BCL2L11      QLQPAERPPQLRPGAPTSLQTEPQDRSPAPM-------------------
A0A0D9SC73_HRK-01       RLGLRSSAAQLTAARLKALGDELHQRT---M-------------------
                                                                          

A0A0D9S2H2_BBC3-01      GPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQW---AQEIG
A0A0D9R4R5_BMF-01       EEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQ------W---QHRAE
A0A0D9QZY8_BIK-01       SDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSL------GLAFIYDQT
A0A0D9R491_BAD-01       RSRHSSYPAGTEEDEGMEEEPSPFRGRSRSAPPNL------WAAQRYGR-
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A0D9RWE0_BCL2L11      -----------------------------------------SCDKSTQTP
A0A0D9SC73_HRK-01       -----------------------------------------WRRRARSRR
                                                                          

A0A0D9S2H2_BBC3-01      AQLRRMADDLNAQYERRRQEEQQ------------RHRPSPW--RVLYNL
A0A0D9R4R5_BMF-01       VQIARKLQCIADQFHRLHVQQHQ------------QNRNRMWWQILLFLH
A0A0D9QZY8_BIK-01       DDIRDVLRSFIDGFTTLR-----------------ENIMRFW--RSL---
A0A0D9R491_BAD-01       -ELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNL---
A0A0D9S003_PMAIP1-      ----KLLNLIAKLFCSGT--------------------------------
A0A0D9RWE0_BCL2L11      SPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRL
A0A0D9SC73_HRK-01       APAPGALPTYWPWLCAAAQVAA-------------------LAAWLLGRR
                                                                          

A0A0D9S2H2_BBC3-01      IMGLLPL-PRGHRAPEMEPN----------------------
A0A0D9R4R5_BMF-01       NLALNGEENRNGAGPR--------------------------
A0A0D9QZY8_BIK-01       --------NPGSWVSREQVLLALLLLALLLALLSGGLHLLLK
A0A0D9R491_BAD-01       --------GRGSSAPSQ-------------------------
A0A0D9S003_PMAIP1-      ------------------------------------------
A0A0D9RWE0_BCL2L11      EK----------------------------------------
A0A0D9SC73_HRK-01       NL----------------------------------------
                                                                  

© 1998-2018