Dataset for protein classical BH3-containing proteins of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5LDM6_BIK-01       MSGVRPISRDTWMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLEC
A0A2K5M0C1_BAD-03       --------------------------------------MFQIPEFEPSEQ
A0A2K5M0C1_BAD-01       --------------------------------------MFQIPEFEPSEQ
A0A2K5M0C1_BAD-02       --------------------------------------MFQIPEFEPSEQ
A0A2K5MJY6_BMF-02       --------------------------------------------------
A0A2K5MJY6_BMF-01       --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
                                                                          

A0A2K5NJZ2_PMAIP1-      ---------------------------------------------MPGKK
A0A2K5LDM6_BIK-01       MEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFICDQTDDI
A0A2K5M0C1_BAD-03       EDSS--------SAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASHQQEQ
A0A2K5M0C1_BAD-01       EDSS--------SAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASHQQEQ
A0A2K5M0C1_BAD-02       EDSS--------SAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASHQQEQ
A0A2K5MJY6_BMF-02       ------------------------MEPSRCVEE------------LEDDV
A0A2K5MJY6_BMF-01       ------------------------MEPSRCVEE------------LEDDV
A0A2K5P2T8_BBC3-03      ---------------IKFGVGSARACPCQVPRAASATWVLCQICGPQPSL
A0A2K5KZ69_HRK-01       ---------------MCPCPLHRGRGPPAV-------------CDCSAGR
A0A2K5NU92_BCL2L11      ----------------------MAKQPSDVSSE----------CDREGRQ
A0A2K5NU92_BCL2L11      ----------------------MAKQPSDVSSE----------CDREGRQ
A0A2K5NU92_BCL2L11      ----------------------MAKQPSDVSSE----------CDREGRQ
A0A2K5NU92_BCL2L11      ----------------------MAKQPSDVSSE----------CDREGRQ
A0A2K5NU92_BCL2L11      ----------------------MAKQPSDVSSE----------CDREGRQ
A0A2K5NU92_BCL2L11      ----------------------MAKQPSDVSSE----------CDREGRQ
A0A2K5NU92_BCL2L11      ----------------------MAKQPSDVSSE----------CDREGRQ
A0A2K5NU92_BCL2L11      ----------------------MAKQPSDVSSE----------CDREGRQ
A0A2K5NU92_BCL2L11      ----------------------MAKQPSDVSSE----------CDREGRQ
A0A2K5NU92_BCL2L11      ----------------------MAKQPSDVSSE----------CDREGRQ
                                                                          

A0A2K5NJZ2_PMAIP1-      ARKNAQPSP--------------------MRAQAELEVECATQ-------
A0A2K5LDM6_BIK-01       RDVLRSFMD-----------------------------------------
A0A2K5M0C1_BAD-03       PTSSSHHGGGAWYSPSWESEDSENPSARMLAEASARMSAPATDSEAQHAE
A0A2K5M0C1_BAD-01       PTSSSHHGG-----------------AGAVETRSRHSSYPAGTEEDE---
A0A2K5M0C1_BAD-02       PTSSSHHGG-----------------TSSPEERGHSDADAAKLQLDASLP
A0A2K5MJY6_BMF-02       FQPEDGEPG--------------------AQPGSSLSADLFAQSLLD---
A0A2K5MJY6_BMF-01       FQPEDGEPG--------------------AQPGSSLSADLFAQSLLD---
A0A2K5P2T8_BBC3-03      LLAEQHLES--------------------PVPSAPGALAGGPTQAAPGVR
A0A2K5KZ69_HRK-01       LGLRSSAAQ--------------------LTAARLKALGDELH-------
A0A2K5NU92_BCL2L11      LQPAERPPQ--------------------LRPGAPTSLQTEPQ-------
A0A2K5NU92_BCL2L11      LQPAERPPQ--------------------LRPGAPTSLQTEPQ-------
A0A2K5NU92_BCL2L11      LQPAERPPQ--------------------LRPGAPTSLQTEPQ-------
A0A2K5NU92_BCL2L11      LQPAERPPQ--------------------LRPGAPTSLQTEPQ-------
A0A2K5NU92_BCL2L11      LQPAERPPQ--------------------LRPGAPTSLQTEPQGNPEGNH
A0A2K5NU92_BCL2L11      LQPAERPPQ--------------------LRPGAPTSLQTEPQGNPEGNH
A0A2K5NU92_BCL2L11      LQPAERPPQ--------------------LRPGAPTSLQTEPQGNPEGNH
A0A2K5NU92_BCL2L11      LQPAERPPQ--------------------LRPGAPTSLQTEPQGNPEGNH
A0A2K5NU92_BCL2L11      LQPAERPPQ--------------------LRPGAPTSLQTEPQGNPEGNH
A0A2K5NU92_BCL2L11      LQPAERPPQ--------------------LRPGAPTSLQTEPQGNPEGNH
                                                                          

A0A2K5NJZ2_PMAIP1-      ---------------------------------------LRRFGDKLNFR
A0A2K5LDM6_BIK-01       ------------GFTTLRENIMRFWRSPNP---------RSWVSHEQVL-
A0A2K5M0C1_BAD-03       NVKLKALGLWRPGVATAPTP-RGRRRT------------KGWRRSPAPF-
A0A2K5M0C1_BAD-01       ------------GMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFV
A0A2K5M0C1_BAD-02       VLVGSELGQG--KLRPLPVTFAPRPETPPALTVLVGHLGYGRKCFPQAL-
A0A2K5MJY6_BMF-02       -------------------------CPLSRLQLFPLTHCCGPGLRPTSQE
A0A2K5MJY6_BMF-01       -------------------------CPLSRLQLFPLTHCCGPGLRPTSQE
A0A2K5P2T8_BBC3-03      GEEEQWAREIGAQLRRMADDLNAQYERRRQE-------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      GGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
A0A2K5NU92_BCL2L11      GGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
A0A2K5NU92_BCL2L11      GGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
A0A2K5NU92_BCL2L11      GGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
A0A2K5NU92_BCL2L11      GGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
A0A2K5NU92_BCL2L11      GGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
                                                                          

A0A2K5NJZ2_PMAIP1-      QKLLNLIAKLFCSGT-----------------------------------
A0A2K5LDM6_BIK-01       -LLLALLLALLSGGLHLLLK------------------------------
A0A2K5M0C1_BAD-03       -GAARAPRPPTSGQHSVMAASSGG--------------------------
A0A2K5M0C1_BAD-01       DSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ-----
A0A2K5M0C1_BAD-02       -CKRGSVLPLSVGGLTQIPFRCM---------------------------
A0A2K5MJY6_BMF-02       DKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPI
A0A2K5MJY6_BMF-01       DKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRVVADP------
A0A2K5P2T8_BBC3-03      ------------EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEM------
A0A2K5KZ69_HRK-01       ------QRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAA------
A0A2K5NU92_BCL2L11      ---------------------------------ASRRQAEPADM------
A0A2K5NU92_BCL2L11      ---DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM----DEATGSS------
A0A2K5NU92_BCL2L11      ---DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGDSS------
A0A2K5NU92_BCL2L11      ---DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM------
A0A2K5NU92_BCL2L11      FDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD-------------
A0A2K5NU92_BCL2L11      FDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE-------------
A0A2K5NU92_BCL2L11      FDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV--------
A0A2K5NU92_BCL2L11      FDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM------
A0A2K5NU92_BCL2L11      FDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM------
A0A2K5NU92_BCL2L11      FDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM------
                                                                          

A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5M0C1_BAD-03       --------------------------------------------------
A0A2K5M0C1_BAD-01       --------------------------------------------------
A0A2K5M0C1_BAD-02       --------------------------------------------------
A0A2K5MJY6_BMF-02       GEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLF
A0A2K5MJY6_BMF-01       -----------PLPAQPCFEWRREQERGGP--------------------
A0A2K5P2T8_BBC3-03      -----------EPN------------------------------------
A0A2K5KZ69_HRK-01       -----------WLLSRRNL-------------------------------
A0A2K5NU92_BCL2L11      -----------RPEIRIAQELRRIGDEFNAYYARRLAELLASST------
A0A2K5NU92_BCL2L11      -----------LRIAL-----------HREVQWPLECLASS---------
A0A2K5NU92_BCL2L11      -----------LWFGFIFTGLDLYGHHHSQDTEQLNHKDFS---------
A0A2K5NU92_BCL2L11      -----------RPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQM
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      -----------RPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQM
A0A2K5NU92_BCL2L11      -----------RPEIRIAQELRRIGDEFNAYYARRMSLPPD---------
A0A2K5NU92_BCL2L11      -----------RPEIRIAQELRRIGDEFNAYYARRLEK------------
                                                                          

A0A2K5NJZ2_PMAIP1-      ------------------
A0A2K5LDM6_BIK-01       ------------------
A0A2K5M0C1_BAD-03       ------------------
A0A2K5M0C1_BAD-01       ------------------
A0A2K5M0C1_BAD-02       ------------------
A0A2K5MJY6_BMF-02       LHNLALNGEENRNGAGPR
A0A2K5MJY6_BMF-01       ------------------
A0A2K5P2T8_BBC3-03      ------------------
A0A2K5KZ69_HRK-01       ------------------
A0A2K5NU92_BCL2L11      ------------------
A0A2K5NU92_BCL2L11      ------------------
A0A2K5NU92_BCL2L11      ------------------
A0A2K5NU92_BCL2L11      VILRLLRYIVRLVWRMH-
A0A2K5NU92_BCL2L11      ------------------
A0A2K5NU92_BCL2L11      ------------------
A0A2K5NU92_BCL2L11      ------------------
A0A2K5NU92_BCL2L11      VILRLLRYIVRLVWRMH-
A0A2K5NU92_BCL2L11      ------------------
A0A2K5NU92_BCL2L11      ------------------
                                          

© 1998-2019