Dataset for protein classical BH3-containing proteins of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5P2T8_BBC3-03      ---------------------------IKFGVGSARACPCQVPRAASATW
A0A2K5KZ69_HRK-01       ---------------------------MCPCPLHRGRGPPAV--------
A0A2K5NU92_BCL2L11      ----------------------------------MAKQPSDVSSE-----
A0A2K5NU92_BCL2L11      ----------------------------------MAKQPSDVSSE-----
A0A2K5NU92_BCL2L11      ----------------------------------MAKQPSDVSSE-----
A0A2K5NU92_BCL2L11      ----------------------------------MAKQPSDVSSE-----
A0A2K5NU92_BCL2L11      ----------------------------------MAKQPSDVSSE-----
A0A2K5NU92_BCL2L11      ----------------------------------MAKQPSDVSSE-----
A0A2K5NU92_BCL2L11      ----------------------------------MAKQPSDVSSE-----
A0A2K5NU92_BCL2L11      ----------------------------------MAKQPSDVSSE-----
A0A2K5NU92_BCL2L11      ----------------------------------MAKQPSDVSSE-----
A0A2K5NU92_BCL2L11      ----------------------------------MAKQPSDVSSE-----
A0A2K5MJY6_BMF-01       MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQS------------
A0A2K5MJY6_BMF-02       MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQS------------
A0A2K5LDM6_BIK-01       --------MSGVRPISRDTWMETLLYEQLLEPLTME--------------
A0A2K5M0C1_BAD-01       --------MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAP
A0A2K5M0C1_BAD-02       --------MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAP
A0A2K5M0C1_BAD-03       --------MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAP
                                                                          

A0A2K5NJZ2_PMAIP1-      -------MPGKKARKNAQPSPMRAQAELEVECATQLRRFGDKL-------
A0A2K5P2T8_BBC3-03      VLCQICGPQPSLLLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAR
A0A2K5KZ69_HRK-01       -----CDCSAGRLGLRSSAAQLTAARLKALGDELH---------------
A0A2K5NU92_BCL2L11      -----CDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A2K5NU92_BCL2L11      -----CDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A2K5NU92_BCL2L11      -----CDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A2K5NU92_BCL2L11      -----CDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A2K5NU92_BCL2L11      -----CDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A2K5NU92_BCL2L11      -----CDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A2K5NU92_BCL2L11      -----CDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A2K5NU92_BCL2L11      -----CDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A2K5NU92_BCL2L11      -----CDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A2K5NU92_BCL2L11      -----CDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A2K5MJY6_BMF-01       --L--LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVML
A0A2K5MJY6_BMF-02       --L--LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVML
A0A2K5LDM6_BIK-01       --V--LGVTDPEEDLDPMEDF------DPLECMEDSDMLALRLACIGDEM
A0A2K5M0C1_BAD-01       GLL--WDASHQQEQPTSSSHHGGA---GAVETRSRHSSYPAGT-----EE
A0A2K5M0C1_BAD-02       GLL--WDASHQQEQPTSSSHHGGT---SSPEERGHSDADAAKL-----QL
A0A2K5M0C1_BAD-03       GLL--WDASHQQEQPTSSSHHGGGAWYSPSWESEDSENPSARM-----LA
                                                                          

A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5P2T8_BBC3-03      EIGAQLRRMADDLNAQYERRRQE---------------------------
A0A2K5KZ69_HRK-01       ------------------------------------------------QR
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      ---------------------------------------------DRSPA
A0A2K5NU92_BCL2L11      ---------------------------------------------DRSPA
A0A2K5NU92_BCL2L11      ---------------------------------------------DRSPA
A0A2K5NU92_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2K5NU92_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2K5NU92_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2K5NU92_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2K5NU92_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2K5NU92_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2K5MJY6_BMF-01       PCGVTEEPQRLF--------------------------YAPAEPKSRVVA
A0A2K5MJY6_BMF-02       PCGVTEEPQRLF--------------------------YGNAGYRLPLPA
A0A2K5LDM6_BIK-01       DVSLRAPRLAQLSEVAMHSLGLAFICDQTDDIRDVLRSFMDGFTTL----
A0A2K5M0C1_BAD-01       DEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPK
A0A2K5M0C1_BAD-02       DASLPVLVGSELGQG---------------KLRPLPVTFAPRPETPPALT
A0A2K5M0C1_BAD-03       EASARMSAPATDSEAQHAE---------NVKLKALGL-WRPGVATAPTPR
                                                                          

A0A2K5NJZ2_PMAIP1-      ----------------NFRQKLLNLIAKLFCSGT----------------
A0A2K5P2T8_BBC3-03      ----EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN-----------
A0A2K5KZ69_HRK-01       TMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLSRRNL------
A0A2K5NU92_BCL2L11      -------------------------ASRRQAEPADMRPEIRIAQELRRIG
A0A2K5NU92_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMDEAT--------------------G
A0A2K5NU92_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGDSSLWFGFIFTGLDLYG
A0A2K5NU92_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIG
A0A2K5NU92_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIG
A0A2K5NU92_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIG
A0A2K5NU92_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIG
A0A2K5NU92_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMGIFE---------------------
A0A2K5NU92_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMANWD---------------------
A0A2K5NU92_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------------
A0A2K5MJY6_BMF-01       DPPL-----PAQPCFEWRR-------------------------------
A0A2K5MJY6_BMF-02       SFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNR
A0A2K5LDM6_BIK-01       -RENIMRFWRSPNPRSWVSHEQVLLL-LALLLALLSGGLHLLLK------
A0A2K5M0C1_BAD-01       SAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ---------------
A0A2K5M0C1_BAD-02       VLVGHLGYGRKCFPQALCK--------RGSVLPLSVGGLTQIPFRCM---
A0A2K5M0C1_BAD-03       GRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAASSGG------------
                                                                          

A0A2K5NJZ2_PMAIP1-      ------------------------------------------
A0A2K5P2T8_BBC3-03      ------------------------------------------
A0A2K5KZ69_HRK-01       ------------------------------------------
A0A2K5NU92_BCL2L11      DEFNAYYARRLAELLASST-----------------------
A0A2K5NU92_BCL2L11      SSLRIALHREVQWPLECLASS---------------------
A0A2K5NU92_BCL2L11      HHHSQDTEQLNHKDFS--------------------------
A0A2K5NU92_BCL2L11      DEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A2K5NU92_BCL2L11      DEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A2K5NU92_BCL2L11      DEFNAYYARRLEK-----------------------------
A0A2K5NU92_BCL2L11      DEFNAYYARRMSLPPD--------------------------
A0A2K5NU92_BCL2L11      ------------------------------------------
A0A2K5NU92_BCL2L11      ------------------------------------------
A0A2K5NU92_BCL2L11      ------------------------------------------
A0A2K5MJY6_BMF-01       ----------------EQERGGP-------------------
A0A2K5MJY6_BMF-02       VWWQILLFLHNLALNGEENRNGAGPR----------------
A0A2K5LDM6_BIK-01       ------------------------------------------
A0A2K5M0C1_BAD-01       ------------------------------------------
A0A2K5M0C1_BAD-02       ------------------------------------------
A0A2K5M0C1_BAD-03       ------------------------------------------
                                                                  

© 1998-2019