Dataset for protein classical BH3-containing proteins of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5P2T8_BBC3-03      ----------------------------------------IKFGVGSARA
A0A2K5KZ69_HRK-01       ----------------------------------------MCPCPLHRGR
A0A2K5NU92_BCL2L11      -----------------------------------------------MAK
A0A2K5NU92_BCL2L11      -----------------------------------------------MAK
A0A2K5NU92_BCL2L11      -----------------------------------------------MAK
A0A2K5NU92_BCL2L11      -----------------------------------------------MAK
A0A2K5NU92_BCL2L11      -----------------------------------------------MAK
A0A2K5NU92_BCL2L11      -----------------------------------------------MAK
A0A2K5NU92_BCL2L11      -----------------------------------------------MAK
A0A2K5NU92_BCL2L11      -----------------------------------------------MAK
A0A2K5NU92_BCL2L11      -----------------------------------------------MAK
A0A2K5NU92_BCL2L11      -----------------------------------------------MAK
A0A2K5MJY6_BMF-01       -------------------------MEPSRCVEELEDDVFQPEDGEPGAQ
A0A2K5MJY6_BMF-02       -------------------------MEPSRCVEELEDDVFQPEDGEPGAQ
A0A2K5LDM6_BIK-01       MSGVRPISRDTWMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLEC
A0A2K5M0C1_BAD-03       --------------------------------------MFQIPEFEPSEQ
A0A2K5M0C1_BAD-01       --------------------------------------MFQIPEFEPSEQ
A0A2K5M0C1_BAD-02       --------------------------------------MFQIPEFEPSEQ
                                                                          

A0A2K5NJZ2_PMAIP1-      --------------------MPGKKARKNAQPSPMRAQAELEVECATQLR
A0A2K5P2T8_BBC3-03      CPCQVPRAASATWVLCQICGPQPSLLLAEQHLESPVPSAPGALAGGPTQA
A0A2K5KZ69_HRK-01       GPPAV-------------CDCSAGRLGLRSSAAQLTAARLKALGDELH--
A0A2K5NU92_BCL2L11      QPSDVSSE----------CDREGRQLQPAERPPQLRPGAPTSLQTEPQ--
A0A2K5NU92_BCL2L11      QPSDVSSE----------CDREGRQLQPAERPPQLRPGAPTSLQTEPQ--
A0A2K5NU92_BCL2L11      QPSDVSSE----------CDREGRQLQPAERPPQLRPGAPTSLQTEPQ--
A0A2K5NU92_BCL2L11      QPSDVSSE----------CDREGRQLQPAERPPQLRPGAPTSLQTEPQ--
A0A2K5NU92_BCL2L11      QPSDVSSE----------CDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K5NU92_BCL2L11      QPSDVSSE----------CDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K5NU92_BCL2L11      QPSDVSSE----------CDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K5NU92_BCL2L11      QPSDVSSE----------CDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K5NU92_BCL2L11      QPSDVSSE----------CDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K5NU92_BCL2L11      QPSDVSSE----------CDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K5MJY6_BMF-01       PGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGP
A0A2K5MJY6_BMF-02       PGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGP
A0A2K5LDM6_BIK-01       MEDSDMLAL-----------------RLACIGDEMDVSLRAPRLAQLSEV
A0A2K5M0C1_BAD-03       EDSS-------------------------SAERGLGPSLAGDRPSDCGKH
A0A2K5M0C1_BAD-01       EDSS-------------------------SAERGLGPSLAGDRPSDCGKH
A0A2K5M0C1_BAD-02       EDSS-------------------------SAERGLGPSLAGDRPSDCGKH
                                                                          

A0A2K5NJZ2_PMAIP1-      RFGDK---------------------------------------------
A0A2K5P2T8_BBC3-03      APGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQE--------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      PEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSS
A0A2K5NU92_BCL2L11      PEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSS
A0A2K5NU92_BCL2L11      PEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSS
A0A2K5NU92_BCL2L11      PEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSS
A0A2K5NU92_BCL2L11      PEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSS
A0A2K5NU92_BCL2L11      PEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSS
A0A2K5MJY6_BMF-01       ASPSQGVMLPCGVTEEPQRLFYAPAE------------------------
A0A2K5MJY6_BMF-02       ASPSQGVMLPCGVTEEPQRLFYGNAG------------------------
A0A2K5LDM6_BIK-01       AMHSLGLAFICDQTDDIRDVLRSFMD------------------------
A0A2K5M0C1_BAD-03       HRQAPGLLWDASHQQEQPTSSSHHGGGAWYSPSWESEDSENPSARMLAEA
A0A2K5M0C1_BAD-01       HRQAPGLLWDASHQQEQPTSSSHHGG-----------------AGAVETR
A0A2K5M0C1_BAD-02       HRQAPGLLWDASHQQEQPTSSSHHGG-----------------TSSPEER
                                                                          

A0A2K5NJZ2_PMAIP1-      ----------------------------LNFRQKLLNLIAKLFCSGT---
A0A2K5P2T8_BBC3-03      -----------------EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEME
A0A2K5KZ69_HRK-01       -----------QRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAW
A0A2K5NU92_BCL2L11      --------------------------------------ASRRQAEPADMR
A0A2K5NU92_BCL2L11      --------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM----DEATGSSL
A0A2K5NU92_BCL2L11      --------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGDSSL
A0A2K5NU92_BCL2L11      --------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMR
A0A2K5NU92_BCL2L11      SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMR
A0A2K5NU92_BCL2L11      SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV---
A0A2K5NU92_BCL2L11      SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE--------
A0A2K5NU92_BCL2L11      SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD--------
A0A2K5NU92_BCL2L11      SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMR
A0A2K5NU92_BCL2L11      SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMR
A0A2K5MJY6_BMF-01       --------------------------PKSRVVADPPL-----PAQPC---
A0A2K5MJY6_BMF-02       --------------------------YRLPLPASFPAVLPIGEQPPE---
A0A2K5LDM6_BIK-01       -----------------------------GFTTLRENIMRFWRSPNP---
A0A2K5M0C1_BAD-03       SARMSAPATDSEAQHAENVKLKALGLWRPGVATAPTP-RGRRRT------
A0A2K5M0C1_BAD-01       SRHSSYPAGTEEDE---------------GMEEEPSPFRGRSRSAPPNLW
A0A2K5M0C1_BAD-02       GHSDADAAKLQLDASLPVLVGSELGQG--KLRPLPVTFAPRPETPPALTV
                                                                          

A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5P2T8_BBC3-03      PN------------------------------------------------
A0A2K5KZ69_HRK-01       LLSRRNL-------------------------------------------
A0A2K5NU92_BCL2L11      PEIRIAQELRRIGDEFNAYYARRLAELLASST------------------
A0A2K5NU92_BCL2L11      RIAL-----------HREVQWPLECLASS---------------------
A0A2K5NU92_BCL2L11      WFGFIFTGLDLYGHHHSQDTEQLNHKDFS---------------------
A0A2K5NU92_BCL2L11      PEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRL
A0A2K5NU92_BCL2L11      PEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRL
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      PEIRIAQELRRIGDEFNAYYARRMSLPPD---------------------
A0A2K5NU92_BCL2L11      PEIRIAQELRRIGDEFNAYYARRLEK------------------------
A0A2K5MJY6_BMF-01       ------FEWRR---------------------------------------
A0A2K5MJY6_BMF-02       ------GQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLF
A0A2K5LDM6_BIK-01       ------RSWVSHEQVL--LLLALLLALLSGGLHLLLK-------------
A0A2K5M0C1_BAD-03       ------KGWRRSPAPF--GAARAPRPPTSGQHSVMAASSGG---------
A0A2K5M0C1_BAD-01       AAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWD
A0A2K5M0C1_BAD-02       LVGHLGYGRKCFPQAL--CKRGSVLPLSVGGLTQIPFRCM----------
                                                                          

A0A2K5NJZ2_PMAIP1-      ------------------
A0A2K5P2T8_BBC3-03      ------------------
A0A2K5KZ69_HRK-01       ------------------
A0A2K5NU92_BCL2L11      ------------------
A0A2K5NU92_BCL2L11      ------------------
A0A2K5NU92_BCL2L11      ------------------
A0A2K5NU92_BCL2L11      VWRMH-------------
A0A2K5NU92_BCL2L11      VWRMH-------------
A0A2K5NU92_BCL2L11      ------------------
A0A2K5NU92_BCL2L11      ------------------
A0A2K5NU92_BCL2L11      ------------------
A0A2K5NU92_BCL2L11      ------------------
A0A2K5NU92_BCL2L11      ------------------
A0A2K5MJY6_BMF-01       --------EQERGGP---
A0A2K5MJY6_BMF-02       LHNLALNGEENRNGAGPR
A0A2K5LDM6_BIK-01       ------------------
A0A2K5M0C1_BAD-03       ------------------
A0A2K5M0C1_BAD-01       RNLGRGSSAPSQ------
A0A2K5M0C1_BAD-02       ------------------
                                          

© 1998-2018