Dataset for protein classical BH3-containing proteins of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5LDM6_BIK-01       MSGVRPISRDTWMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLEC
A0A2K5M0C1_BAD-02       --------------------------------------MFQIPEFEPSEQ
A0A2K5M0C1_BAD-03       --------------------------------------MFQIPEFEPSEQ
A0A2K5M0C1_BAD-01       --------------------------------------MFQIPEFEPSEQ
A0A2K5MJY6_BMF-01       --------------------------------------------MEPSRC
A0A2K5MJY6_BMF-02       --------------------------------------------MEPSRC
A0A2K5P2T8_BBC3-03      -----------------------------------IKFGVGSARACPCQV
A0A2K5KZ69_HRK-01       -----------------------------------MCPCPLHRGRGPPAV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
                                                                          

A0A2K5NJZ2_PMAIP1-      ---------------MPGKKARKNAQPSPMRAQAELEV------------
A0A2K5LDM6_BIK-01       MEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFICDQTDDI
A0A2K5M0C1_BAD-02       EDSS--------SAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASHQQEQ
A0A2K5M0C1_BAD-03       EDSS--------SAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASHQQEQ
A0A2K5M0C1_BAD-01       EDSS--------SAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASHQQEQ
A0A2K5MJY6_BMF-01       VEE------------LEDDVFQPEDGEPGAQPGSSLSA-------DLFAQ
A0A2K5MJY6_BMF-02       VEE------------LEDDVFQPEDGEPGAQPGSSLSA-------DLFAQ
A0A2K5P2T8_BBC3-03      PRAASATWVLCQICGPQPSLLLAEQHLESPVPSAPGAL-------AGGPT
A0A2K5KZ69_HRK-01       -------------CDCSAGRLGLRSSAAQLTAARLKAL-------GDELH
A0A2K5NU92_BCL2L11      SSE----------CDREGRQLQPAERPPQLRPGAPTSL-------QTEPQ
A0A2K5NU92_BCL2L11      SSE----------CDREGRQLQPAERPPQLRPGAPTSL-------QTEPQ
A0A2K5NU92_BCL2L11      SSE----------CDREGRQLQPAERPPQLRPGAPTSL-------QTEPQ
A0A2K5NU92_BCL2L11      SSE----------CDREGRQLQPAERPPQLRPGAPTSL-------QTEPQ
A0A2K5NU92_BCL2L11      SSE----------CDREGRQLQPAERPPQLRPGAPTSL-------QTEPQ
A0A2K5NU92_BCL2L11      SSE----------CDREGRQLQPAERPPQLRPGAPTSL-------QTEPQ
A0A2K5NU92_BCL2L11      SSE----------CDREGRQLQPAERPPQLRPGAPTSL-------QTEPQ
A0A2K5NU92_BCL2L11      SSE----------CDREGRQLQPAERPPQLRPGAPTSL-------QTEPQ
A0A2K5NU92_BCL2L11      SSE----------CDREGRQLQPAERPPQLRPGAPTSL-------QTEPQ
A0A2K5NU92_BCL2L11      SSE----------CDREGRQLQPAERPPQLRPGAPTSL-------QTEPQ
                                                                          

A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5LDM6_BIK-01       RDVLRSFMD-----------------------------------------
A0A2K5M0C1_BAD-02       PTSSSHHGG-----------------TSSPEERGHSDADAAKLQLDASLP
A0A2K5M0C1_BAD-03       PTSSSHHGGGAWYSPSWESEDSENPSARMLAEASARMSAPATDSEAQHAE
A0A2K5M0C1_BAD-01       PTSSSHHGG-----------------AGAVETRSRHSSYPAGTEEDE---
A0A2K5MJY6_BMF-01       SLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCG
A0A2K5MJY6_BMF-02       SLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCG
A0A2K5P2T8_BBC3-03      QAAPGVRGEEE----QWAREIGAQLRRMADDLNAQYERRRQE--------
A0A2K5KZ69_HRK-01       --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      GNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSS
A0A2K5NU92_BCL2L11      GNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSS
A0A2K5NU92_BCL2L11      GNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSS
A0A2K5NU92_BCL2L11      GNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSS
A0A2K5NU92_BCL2L11      GNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSS
A0A2K5NU92_BCL2L11      GNPEGNHGGEG----DSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSS
                                                                          

A0A2K5NJZ2_PMAIP1-      -----------------------ECATQLRRFGDKLNFRQKLLNLIAKLF
A0A2K5LDM6_BIK-01       ------------GFTTLRENIMRFWRSPNP---------RSWVSHEQVL-
A0A2K5M0C1_BAD-02       VLVGSELGQG--KLRPLPVTFAPRPETPPALTVLVGHLGYGRKCFPQAL-
A0A2K5M0C1_BAD-03       NVKLKALGLWRPGVATAPTP-RGRRRT------------KGWRRSPAPF-
A0A2K5M0C1_BAD-01       ------------GMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFV
A0A2K5MJY6_BMF-01       VTEEPQRLFYAPAEPKSRVVADPPL-----PAQPCFEWRR----------
A0A2K5MJY6_BMF-02       VTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKL
A0A2K5P2T8_BBC3-03      -----------------------EQQRHR-PSPWRVLYNLIMGLLPLPRG
A0A2K5KZ69_HRK-01       -----------------QRTMWRRRARSR-RAPAPGALPTYWPWLCAAAQ
A0A2K5NU92_BCL2L11      ---------------------------------------------ASRRQ
A0A2K5NU92_BCL2L11      --------------DRSPAPMSCDKSTQT-PSPPCQAFNHYLSAM----D
A0A2K5NU92_BCL2L11      --------------DRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMVVILE
A0A2K5NU92_BCL2L11      --------------DRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMASRRQ
A0A2K5NU92_BCL2L11      LLSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMVREIE
A0A2K5NU92_BCL2L11      LLSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMGIFE-
A0A2K5NU92_BCL2L11      LLSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMANWD-
A0A2K5NU92_BCL2L11      LLSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMASRRQ
A0A2K5NU92_BCL2L11      LLSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMASRRQ
A0A2K5NU92_BCL2L11      LLSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPPCQAFNHYLSAMASRRQ
                                                                          

A0A2K5NJZ2_PMAIP1-      CSGT----------------------------------------------
A0A2K5LDM6_BIK-01       -LLLALLLALLSGGLHLLLK------------------------------
A0A2K5M0C1_BAD-02       -CKRGSVLPLSVGGLTQIPFRCM---------------------------
A0A2K5M0C1_BAD-03       -GAARAPRPPTSGQHSVMAASSGG--------------------------
A0A2K5M0C1_BAD-01       DSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ-----
A0A2K5MJY6_BMF-01       -------------------------------------EQERGGP------
A0A2K5MJY6_BMF-02       QCIADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR---
A0A2K5P2T8_BBC3-03      HRAPEMEPN-----------------------------------------
A0A2K5KZ69_HRK-01       VAALAAWLLSRRNL------------------------------------
A0A2K5NU92_BCL2L11      AEPADMRPEIRIAQELRRIGDEFNAYYARRLAELLASST-----------
A0A2K5NU92_BCL2L11      EATGSSLRIAL-----------HREVQWPLECLASS--------------
A0A2K5NU92_BCL2L11      DIGDSSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS--------------
A0A2K5NU92_BCL2L11      AEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRL
A0A2K5NU92_BCL2L11      EVVV----------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      AEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRL
A0A2K5NU92_BCL2L11      AEPADMRPEIRIAQELRRIGDEFNAYYARRLEK-----------------
A0A2K5NU92_BCL2L11      AEPADMRPEIRIAQELRRIGDEFNAYYARRMSLPPD--------------
                                                                          

A0A2K5NJZ2_PMAIP1-      ------------
A0A2K5LDM6_BIK-01       ------------
A0A2K5M0C1_BAD-02       ------------
A0A2K5M0C1_BAD-03       ------------
A0A2K5M0C1_BAD-01       ------------
A0A2K5MJY6_BMF-01       ------------
A0A2K5MJY6_BMF-02       ------------
A0A2K5P2T8_BBC3-03      ------------
A0A2K5KZ69_HRK-01       ------------
A0A2K5NU92_BCL2L11      ------------
A0A2K5NU92_BCL2L11      ------------
A0A2K5NU92_BCL2L11      ------------
A0A2K5NU92_BCL2L11      LRYIVRLVWRMH
A0A2K5NU92_BCL2L11      ------------
A0A2K5NU92_BCL2L11      ------------
A0A2K5NU92_BCL2L11      ------------
A0A2K5NU92_BCL2L11      LRYIVRLVWRMH
A0A2K5NU92_BCL2L11      ------------
A0A2K5NU92_BCL2L11      ------------
                                    

© 1998-2019