Dataset for protein Bmf of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5MJY6_BMF-01      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A2K5MJY6_BMF-02      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
                       **************************************************

A0A2K5MJY6_BMF-01      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPA
A0A2K5MJY6_BMF-02      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
                       ***********************************************. *

A0A2K5MJY6_BMF-01      EPKSRVVADPPL-----PAQPCFEWRR-----------------------
A0A2K5MJY6_BMF-02      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
                         .  : *. *         *  :*..                       

A0A2K5MJY6_BMF-01      ------------------------EQERGGP---
A0A2K5MJY6_BMF-02      QHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR
                                               *::*.*.   

© 1998-2018