Dataset for protein Bad of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5M0C1_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
A0A2K5M0C1_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
A0A2K5M0C1_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
                       **************************************************

A0A2K5M0C1_BAD-01      QQEQPTSSSHHGGA---GAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRS
A0A2K5M0C1_BAD-02      QQEQPTSSSHHGGT---SSPEERGHSDADAAKLQLDASLPVLVGSELGQG
A0A2K5M0C1_BAD-03      QQEQPTSSSHHGGGAWYSPSWESEDSENPSARMLAEASARMSAPATDSEA
                       *************    ..       .  .*    : .      .  . .

A0A2K5M0C1_BAD-01      RSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWT
A0A2K5M0C1_BAD-02      ---------------KLRPLPVTFAPRPETPPALTVLVGHLGYGRKCFPQ
A0A2K5M0C1_BAD-03      QHAE---------NVKLKALGL-WRPGVATAPTPRGRRRTKGWRRSPAPF
                                      :*. :   :       *            ..    

A0A2K5M0C1_BAD-01      RVFQSWWDRNLGRGSSAPSQ------------
A0A2K5M0C1_BAD-02      ALCK--------RGSVLPLSVGGLTQIPFRCM
A0A2K5M0C1_BAD-03      GAARAPRPPTSGQHSVMAASSGG---------
                          .        . *  . .            

© 1998-2018