Dataset for protein Bad of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5M0C1_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
A0A2K5M0C1_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
A0A2K5M0C1_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASH
                       **************************************************

A0A2K5M0C1_BAD-03      QQEQPTSSSHHGGGAWYSPSWESEDSENPSARMLAEASARMSAPATDSEA
A0A2K5M0C1_BAD-01      QQEQPTSSSHHGG-----------------AGAVETRSRHSSYPAGTEED
A0A2K5M0C1_BAD-02      QQEQPTSSSHHGG-----------------TSSPEERGHSDADAAKLQLD
                       *************                 :      .   : .*  .  

A0A2K5M0C1_BAD-03      QHAENVKLKALGLWRPGVATAPTP-RGRRRT------------KGWRRSP
A0A2K5M0C1_BAD-01      E---------------GMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMS
A0A2K5M0C1_BAD-02      ASLPVLVGSELGQG--KLRPLPVTFAPRPETPPALTVLVGHLGYGRKCFP
                                        :   * .   *  :               .  .

A0A2K5M0C1_BAD-03      APF--GAARAPRPPTSGQHSVMAASSGG---------------------
A0A2K5M0C1_BAD-01      DEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
A0A2K5M0C1_BAD-02      QAL--CKRGSVLPLSVGGLTQIPFRCM----------------------
                         :         * : *  : :   .                       

© 1998-2019