Dataset for protein classical BH3-containing proteins of organism Cebus capucinus imitator

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5QQC6_PMAIP1-      -------------------------------------MPGKKARKSAQPS
A0A2K5PIE7_HRK-01       -------------------MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQ
A0A2K5QXZ1_BIK-01       MSEERPLSIDILMETLLCEQFMDPLTMEVVGGGSDPEEDLDPVEDPLECM
A0A2K5RN49_BMF-01       -----------------------------MEPSQCVEELEDDVFQPEDGE
A0A2K5Q1Y0_BCL2L11      -------------------------MAKQPSDVSSECDREGRQLQPAERP
A0A2K5Q1Y0_BCL2L11      -------------------------MAKQPSDVSSECDREGRQLQPAERP
A0A2K5PDB1_BAD-01       -------------------MFQIPEFEPSEQEGSSSAERGLNPSTAGDSP
A0A2K5PDB1_BAD-03       -------------------MFQIPEFEPSEQEGSSSAERGLNPSTAGDSP
A0A2K5QNS7_BBC3-02      -MKCGVGSAWACPCQVPRASSSVWVPCQMCGPQPSLSLAEQHLESPVPSA
A0A2K5RN49_BMF-02       -----------------------------MEPSQCVEELEDDVFQPEDGE
                                                                     .    

A0A2K5QQC6_PMAIP1-      PAPAPADLEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT---------
A0A2K5PIE7_HRK-01       LTAARLKALGDELHQRTMWRRRARSRRAPAPSALPTYWPWLCAAAQVAAL
A0A2K5QXZ1_BIK-01       ENSDALALQLACIADQMDVSLRARKL--AQLYEVAMYSPGLAVTLDQTDI
A0A2K5RN49_BMF-01       PGTQPGSLLSADLFAQSLLDCPLSRL--QLFPLTHCCGPGLRPTSQEDKA
A0A2K5Q1Y0_BCL2L11      P------QLR----------------------------PGAPTSLQTEPQ
A0A2K5Q1Y0_BCL2L11      P------QLR----------------------------PGAPTSLQTEPQ
A0A2K5PDB1_BAD-01       PGSGKHRRQA----------------------------PGLPGDASHQQG
A0A2K5PDB1_BAD-03       PGSGKHRRQA----------------------------PGLPGDASHQQG
A0A2K5QNS7_BBC3-02      PGALAGGPTQAALGVRGEEEQWAREIGAQLQRMADDLNAQYERRRQEEQP
A0A2K5RN49_BMF-02       PGTQPGSLLSADLFAQSLLDCPLSRL--QLFPLTHCCGPGLRPTSQEDKA
                                                              .           

A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A2K5PIE7_HRK-01       AAWLLGRRNL----------------------------------------
A0A2K5QXZ1_BIK-01       RDVLGGIVD-----------------------------------------
A0A2K5RN49_BMF-01       TQTLSPASP-----------SQGVMLPCGVTEEPQRLFYGNAGYRLPLPA
A0A2K5Q1Y0_BCL2L11      GNPEGNHGG------------EGDSCPHGSPQGP---------LAPPASP
A0A2K5Q1Y0_BCL2L11      GNPEGNHGG------------EGDSCPHGSPQGP---------LAPPASP
A0A2K5PDB1_BAD-01       QPTSSSHHG---GAGAVETRSRHRSYPAGTEEDE---------GMEEEPS
A0A2K5PDB1_BAD-03       QPTSSSHHGENPSARMLSKTSAGMSSPATDSEAQ---------HTENVKL
A0A2K5QNS7_BBC3-02      QHRPSPWRV-----------LYNLIM--GLLPFPRGH------RAPEMEP
A0A2K5RN49_BMF-02       TQTLSPASP-----------SQGVMLPCGVTEEPQRL------FYAPAEP
                                                                          

A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
A0A2K5QXZ1_BIK-01       ---------------------------IFANFQEDVVRLWRSLSSGSWVS
A0A2K5RN49_BMF-01       SFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQF----HQLHVQQHQQ
A0A2K5Q1Y0_BCL2L11      GPFA-----TRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2K5Q1Y0_BCL2L11      GPFA-----TRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQ
A0A2K5PDB1_BAD-01       TFRG--RSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQ
A0A2K5PDB1_BAD-03       EALGLWRPGVATDRTPQGRRRTKGWRRSPAPF--GAVRARHPPTSGQHSA
A0A2K5QNS7_BBC3-02      N-------------------------------------------------
A0A2K5RN49_BMF-02       KSRVVAGPPLPAQPGFEWRREQEWGRPE----------------------
                                                                          

A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
A0A2K5QXZ1_BIK-01       RKQAVLLAFLALLLAT---------------------------------F
A0A2K5RN49_BMF-01       NRNRVWWQVLLFLHNLALNGEENRNGAGLR--------------------
A0A2K5Q1Y0_BCL2L11      TPSPTCQAFNHYLSAM----------------------VREIEEVVV---
A0A2K5Q1Y0_BCL2L11      TPSPTCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDEFNAYY
A0A2K5PDB1_BAD-01       MRQSASW-------------------------------TRVIQSWWDRNL
A0A2K5PDB1_BAD-03       MAASS---------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K5RN49_BMF-02       --------------------------------------------------
                                                                          

A0A2K5QQC6_PMAIP1-      ---------
A0A2K5PIE7_HRK-01       ---------
A0A2K5QXZ1_BIK-01       SGGLHLLLK
A0A2K5RN49_BMF-01       ---------
A0A2K5Q1Y0_BCL2L11      ---------
A0A2K5Q1Y0_BCL2L11      PRRISLPSD
A0A2K5PDB1_BAD-01       GRGGSAPSQ
A0A2K5PDB1_BAD-03       --GG-----
A0A2K5QNS7_BBC3-02      ---------
A0A2K5RN49_BMF-02       ---------
                                 

© 1998-2019