Dataset for protein Bim of organism Cebus capucinus imitator

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5Q1Y0_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5Q1Y0_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                        **************************************************

A0A2K5Q1Y0_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K5Q1Y0_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
                        **************************************************

A0A2K5Q1Y0_BCL2L11      TDRSPAPMSCDKSTQTPSPTCQAFNHYLSAM-------------------
A0A2K5Q1Y0_BCL2L11      TDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMASMRQSQAEPAGMRPEIWI
                        *******************************                   

A0A2K5Q1Y0_BCL2L11      ---VREIEEVVV------------
A0A2K5Q1Y0_BCL2L11      AQELRRIGDEFNAYYPRRISLPSD
                           :* * : .             

© 1998-2019