Dataset for protein classical BH3-containing proteins of organism Cavia porcellus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A286XF37_PMAIP1-      --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
H0W025_BIK-01           -------------------------------------------------M
A0A286XJN2_BCL2L11      ------------------------------------------------MA
A0A286XJN2_BCL2L11      ------------------------------------------------MA
A0A286XJN2_BCL2L11      ------------------------------------------------MA
A0A286XXB0_BMF-03       -----------------------------------------------VFP
A0A286XXB0_BMF-01       --------------------------------------------------
A0A286XXB0_BMF-02       MPGAGVFWKQYRARRRRRGPDPPRVFVTLDPGTEPWHHDSEADSLSWSHP
                                                                          

A0A286XF37_PMAIP1-      --------------------------------------------------
H0V608_BAD-01           ----------MFQIPEFEPSEQEDSSSEERGLGPSPTGDELGSSPAGG--
H0W025_BIK-01           SEAKPVARDPLMETPLFEPPPGPLLAEGALGVTQPLWAEDL-SPPGDT--
A0A286XJN2_BCL2L11      KQPSDVSCECDREGGQLQPAERPSQLRAGAPTSLQTEPQ-----------
A0A286XJN2_BCL2L11      KQPSDVSCECDREGGQLQPAERPSQLRAGAPTSLQTEPQGN---PEGAGD
A0A286XJN2_BCL2L11      KQPSDVSCECDREGGQLQPAERPSQLRAGAPTSLQTEPQGN---PEGAGD
A0A286XXB0_BMF-03       REMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLGRLH
A0A286XXB0_BMF-01       --MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLGRLH
A0A286XXB0_BMF-02       GEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLGRLH
                                                                          

A0A286XF37_PMAIP1-      ----------------------------------------------MPGK
H0V608_BAD-01           -------------------------------------------FLGDTSH
H0W025_BIK-01           -------------------------------------------NLMECVE
A0A286XJN2_BCL2L11      ------------------------------------------------DR
A0A286XJN2_BCL2L11      RSPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDR
A0A286XJN2_BCL2L11      RSPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDR
A0A286XXB0_BMF-03       LFPLTHCCGPGLRPTSQE------------------------------DK
A0A286XXB0_BMF-01       LFPLTHCCGPGLRPTSQE------------------------------DK
A0A286XXB0_BMF-02       LFPLTHCCGPGLRPTSQE------------------------------DK
                                                                          

A0A286XF37_PMAIP1-      VCKSAQPNSTRAELEVECAAQLRRVGDTLNSLGCTTEALEVLAEMAGKKA
H0V608_BAD-01           QQRQLRSSRSHHGGTVAMETRSRHRSYPAG--------TEEEEGMEEELS
H0W025_BIK-01           GSSLVALRLACIGDEMDLRLRSPRLAQLPGRAVHSLAITYSQMGLWGVLG
A0A286XJN2_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNH------------------YLSAMASMR
A0A286XJN2_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNH------------------YLSAMASMR
A0A286XJN2_BCL2L11      SPAPMSCDKSTQTPSPPCQAFNH------------------YLSAMASMR
A0A286XXB0_BMF-03       ATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGE
A0A286XXB0_BMF-01       ATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGE
A0A286XXB0_BMF-02       ATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGE
                                 .                                        

A0A286XF37_PMAIP1-      RKSSEPDPARARAELEVECAAQLRRIGDKLNFQ-----------------
H0V608_BAD-01           PFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATKLW
H0W025_BIK-01           RLTLSLASLRDNVWACGR--------------------------PASRAW
A0A286XJN2_BCL2L11      QSQAGPPHLRPEIWIAQE----LRRIGDEFNASYPRRVFLNHYQPAEDQP
A0A286XJN2_BCL2L11      QSQAGPPHLRPEIWIAQE----LRRIGDEFNASYPRRVFLNHYQPAEDQP
A0A286XJN2_BCL2L11      QSQAGPPHLRPEIWIAQE----LRRIGDEFNASYPRRVFLNHYQPAEDQP
A0A286XXB0_BMF-03       QPPEGQWQHRAEVQIARK----LQCIADQFH-----RLHIQQHQQNRNR-
A0A286XXB0_BMF-01       QPPEGQWQHRAEVQIARK----LQCIADQFH-----RLHIQQHQQNRNR-
A0A286XXB0_BMF-02       QPPEGQWQHRAEVQIARK----LQCIADQFH-----RLHIQQHQQNRNR-
                                                                          

A0A286XF37_PMAIP1-      ------------------------QKLMYLISKLISLVT--------
H0V608_BAD-01           QNSNWT------------------RAIQSWWDRNLGRGGSAPSQESV
H0W025_BIK-01           VSPRWTCRWLLPVLLLLLLLLGTLRLLLQ------------------
A0A286XJN2_BCL2L11      QMVIL-------------------RLLRYIIRLVWRMH---------
A0A286XJN2_BCL2L11      QMVIL-------------------RLLRYIIRLVWRMH---------
A0A286XJN2_BCL2L11      QMVIL-------------------RLLRYIIRLVWRMH---------
A0A286XXB0_BMF-03       --AWW-------------------QVLLFMHNLGLNGEENREGAGPR
A0A286XXB0_BMF-01       --AWW-------------------QVLLFMHNLGLNGEENREGAGPR
A0A286XXB0_BMF-02       --AWW-------------------QVLLFMHNLGLNGEENREGAGPR
                                                . :                    

© 1998-2018