Dataset for protein Bim of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452FCS1_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDR
A0A452FCS1_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQ---------
                        *****************************************         

A0A452FCS1_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A452FCS1_BCL2L11      -----------------------------------------------DRS
                                                                       ***

A0A452FCS1_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQEL
A0A452FCS1_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQEL
                        **************************************************

A0A452FCS1_BCL2L11      RRIGDEFNAYYPRRVFVRHQAIEGHPQMVLLRVLRYLVRLVWRMQ
A0A452FCS1_BCL2L11      RRIGDEFNAYYPRRVFVRHQAIEGHPQMVLLRVLRYLVRLVWRMQ
                        *********************************************

© 1998-2019