Dataset for protein Bad of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452ER54_BAD-01      MGTPENPSAAPTTRKLSIRRRRRESGGRQWAGPRGSMFQIPEFEQSEQED
A0A452ER54_BAD-02      --------------------------YRAWA---QSMFQIPEFEQSEQED
                                                  * **    ***************

A0A452ER54_BAD-01      SSPADRGLGPSPTGDRPPGLT------PGLLGEAGHQQGQPAGSSHHGGT
A0A452ER54_BAD-02      SSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGT
                       ********************:      ***********************

A0A452ER54_BAD-01      GAVETRSRHSSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRE
A0A452ER54_BAD-02      GAVETRSRHSSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRE
                       **************************************************

A0A452ER54_BAD-01      LRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGS
A0A452ER54_BAD-02      LRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGS
                       **************************************************

A0A452ER54_BAD-01      APSQ
A0A452ER54_BAD-02      APSQ
                       ****

© 1998-2019