Dataset for protein classical BH3-containing proteins of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q1PCT2_PMAIP1-01       --------------------------------------------------
E2RLD4_HRK-01          --------------------------------------------------
J9NTK9_BBC3-01         MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLP---AA
J9NWV6_BCL2L11-01      -------------------------MAKQPSDVSSECDREGGQLQ---PA
F1PUF4_BIK-01          --------------------------------MSHSGPLSRNLFLSTFLQ
J9PB65_BMF-01          -----------------------------MEPPQCVEELEDDVFQ---PE
F1PK10_BAD-01          --TPENPSSAPAQDPGTRKSGTERREKSCALTTCCLAPTAQSMFQ---IP
Q45KI9_BAD-01          ------------------------------------------MFQ---IP
                                                                         

Q1PCT2_PMAIP1-01       --------------------------------------------------
E2RLD4_HRK-01          ------------------------------------------------MC
J9NTK9_BBC3-01         PAAPALLPAAYLCAPTAPPAVTAALGGP------------RWPGGPRSRP
J9NWV6_BCL2L11-01      ERPPQLRPGAPTSLQTEQQGNPEGEGDR---------CPQGSPQGPLAPP
F1PUF4_BIK-01          EHGPEVLEVP------------------------------GMTDLVEYYD
J9PB65_BMF-01          DGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGL--------
F1PK10_BAD-01          EFEPSEQEDS-------------SPANR------------GL--------
Q45KI9_BAD-01          EFEPSEQEDS-------------SPANR------------GL--------
                                                                         

Q1PCT2_PMAIP1-01       -MPGRKARKSAQPGPTRAPEEL----------------------------
E2RLD4_HRK-01          PCPLHRGRGPPAVCACSAGRLALRSSAAQLT-------------------
J9NTK9_BBC3-01         RGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQW--
J9NWV6_BCL2L11-01      ASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTP
F1PUF4_BIK-01          PGPSPNSNNPD---------------------DVAMRLAFIGDEMEVRWM
J9PB65_BMF-01          -RPTSQEDKATQTLSPASPSQGVMLPCGVT--EEPQRLFYGNAGYRL---
F1PK10_BAD-01          -GPSPTGDRPPSPGKHQQTAPGLLGEAGHQQGQPASRKHHGGAGAETR--
Q45KI9_BAD-01          -GPSPTGDRPPSPGKHQQTAPGLLGEAGHQQGQPASRKHHGGAGAETR--
                         *      .                                        

Q1PCT2_PMAIP1-01       --------------------------------------EVECAIQLRKFG
E2RLD4_HRK-01          ------------------------------------------AARLKALG
J9NTK9_BBC3-01         --------------------------------------AREIGAQLRRMA
J9NWV6_BCL2L11-01      SPPCQAFNHYLSAMASMR---------QSQAVPADMRPEIWIAQELRRIG
F1PUF4_BIK-01          LPRVGELP----------------------------------GMAMYSLA
J9PB65_BMF-01          -PLPASFPAGL------------PLLEQPPEGQWQHRAEVQIARKLQCIA
F1PK10_BAD-01          -SRHSSFPAGTDEDEGMEEEELSPFRGRSSSAPPNLCAARRYGRELRRMS
Q45KI9_BAD-01          -SRHSSFPAGTDEDEGMEEEELSPFRGRSSSAPPNLCAARRYGRELRRMS
                                                                 .  :  :.

Q1PCT2_PMAIP1-01       DKL-----------------------------------------------
E2RLD4_HRK-01          DEL---------------------------------HQRTMWRRRARSRR
J9NTK9_BBC3-01         DDL------------------------------NALYERRRQEEQQRHRP
J9NWV6_BCL2L11-01      DEF------------------------------NAYYPRRVFLNNYQAAE
F1PUF4_BIK-01          FTYNQTGLRGVLRSFLDGLANLRENIRIWSFLTFR----------NRVSP
J9PB65_BMF-01          DQF-H---------RLHMQQHQQNQNRVWWQILLFLHNLALNADENRNGA
F1PK10_BAD-01          DEF-QGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNL----GRGGS
Q45KI9_BAD-01          DEF-QGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNL----GRGGS
                                                                         

Q1PCT2_PMAIP1-01       ----NFRQKLLNLLSKLFRSGT-----------
E2RLD4_HRK-01          APAPRALPTYWPWLCAAAQVAALAAWLLGRRNL
J9NTK9_BBC3-01         SPWRVLYNLIMGLLPLPRGRGAPEMEPN-----
J9NWV6_BCL2L11-01      AHPQMIILRLLRYIVRLVWRLQ-----------
F1PUF4_BIK-01          NPGRGLVLSLLLLLVLLLGWGLRLLQ-------
J9PB65_BMF-01          GPSFQLVPGISCSGAQQDCSCL-----------
F1PK10_BAD-01          APSQ-----------------------------
Q45KI9_BAD-01          APSQ-----------------------------
                                                        

© 1998-2018