Dataset for protein Puma of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


J9NTK9_BBC3-01      MQGLPGHVPVRCSGFPSGPVGPPSDLCQARLDVPAPECVPISGPVTRNLLQAPGSAMARA
J9NTK9_BBC3-03      ---MPCVTPRLGPRERHGPSTPGGQLPGARRGPGPRRSAPVSPQPPGALGRVLRPLRARP
J9NTK9_BBC3-02      ---MPCVTPRLGPRERHGPSTPGGQLPGARRGPGPRRSAPVSPQPPGALGRVLRPLRARP
                       :*  .*   .    **  * .:*  ** .  .  ..*:*   .  * ..  .  **.

J9NTK9_BBC3-01      RQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAP-T
J9NTK9_BBC3-03      ARRPCCPCP-------AARCLPLRPHRPARRHRRPGGPPLAWGSPQPAPRPAPRRSSALT
J9NTK9_BBC3-02      ARRPCCPCP-------AARCLPLRPHRPARRHRRPGGPPLAWGSPQPAPRPAPRRSSALT
                     .  ..* *       ..* :**    *:        * *. ... **  **.  .:. *

J9NTK9_BBC3-01      APPAVTAALGGPRWPGGP--RSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQ
J9NTK9_BBC3-03      VAGGTAPGIAGAQRPGGPGGRSHPSSPGSPGGGGAVGPGDR--------GPAAADGGRPQ
J9NTK9_BBC3-02      VAGGTAPGIAGAQRPGGPGGRSHPSSPGSPGGGGAVGPGDR--------GPAAADGGRPQ
                    .. ..:..:.*...****  **.* .* . *   ::.*.:.        .*.*  ** .*

J9NTK9_BBC3-01      AAPGVRGEEEQWAREIGAQLRRMADDLNALYERRVSVGGGVDGRWDFPPGRGLRAAPPDV
J9NTK9_BBC3-03      RA--VRAAGECWGRG--------------------------RRQVGLPAREGAAGGPARC
J9NTK9_BBC3-02      RA--VRAA----------------------------------------ETRGAAATPPLT
                     *  **.                                            *  . *.  

J9NTK9_BBC3-01      -------RQLLPGAAGSRWG-----------------QAGGMGDGPTDLPKGPRRGWHDP
J9NTK9_BBC3-03      --AAAAARRGGVALGTGRWDGRRAHGPAEGPAPRLARPGQGP--GPPRAPRRVR--GPRP
J9NTK9_BBC3-02      LEGPVQSHHGTPALTQGPWS-----------------PGDGAQLGACTRPVDIRDLGGRT
                           ..   .   . *.                  . *   *.   *   *     .

J9NTK9_BBC3-01      GKGRDRLERRGASVALGRGD
J9NTK9_BBC3-03      RGLRAALGGAAHISRAIYSR
J9NTK9_BBC3-02      LPPPDALASAGDFFCTM---
                          *   .         

© 1998-2019