Dataset for protein classical BH3-containing proteins of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

17 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7GW45_PMAIP1-01        ----------------------------MPGKKARKSAQPSP--------
U3E722_HRK-01           ----------------------MCPC-------PLHRGRGPPAVCACSAG
F7HPK0_BMF-02           --------------------MEPSQCVEELEDDVFQPEDGEP------GT
F7HPK0_BMF-01           --------------------MEPSQCVEELEDDVFQPEDGEP------GT
A0A2R8MW85_BBC3-03      MKCGVGSAWACPCQVPRASSSVWVPC--QMCGPQPSLSLAEQHLE---SP
F7FUT7_BIK-01           --------MSEVRPLSSDIFMETLLC--EQFVDPLTM-----------EV
F6XMC1_BCL2L11-01       --------------MAKQPSDVSSEC--DREGRQLQPAERPP------QL
F6XMC1_BCL2L11-09       --------------MAKQPSDVSSEC--DREGRQLQPAERPP------QL
F6XMC1_BCL2L11-02       --------------MAKQPSDVSSEC--DREGRQLQPAERPP------QL
F6XMC1_BCL2L11-03       --------------MAKQPSDVSSEC--DREGRQLQPAERPP------QL
F6XMC1_BCL2L11-08       --------------MAKQPSDVSSEC--DREGRQLQPAERPP------QL
F6XMC1_BCL2L11-05       --------------MAKQPSDVSSEC--DREGRQLQPAERPP------QL
F6XMC1_BCL2L11-07       --------------MAKQPSDVSSEC--DREGRQLQPAERPP------QL
F6XMC1_BCL2L11-06       --------------MAKQPSDVSSEC--DREGRQLQPAERPP------QL
F6XMC1_BCL2L11-04       --------------MAKQPSDVSSEC--DREGRQLQPAERPP------QL
F6SJL0_BAD-02           --------MFQIPEFEPSEQEDSSSA--ERGLSPSTAGDRPPGSGKHRRQ
F6SJL0_BAD-01           --------MFQIPEFEPSEQEDSSSA--ERGLSPSTAGDRPPGSGKHRRQ
                                                                          

F7GW45_PMAIP1-01        --------------------------------------------------
U3E722_HRK-01           RLGLRSSAAQLTAARLK---------------------------------
F7HPK0_BMF-02           QPGSLLSADLFAQ-------------SLLDCPLSRLQLFPLTHCCGPGLR
F7HPK0_BMF-01           QPGSLLSADLFAQ-------------SLLDCPLSRLQLFPLTHCCGPGLR
A0A2R8MW85_BBC3-03      VPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQL-----RRMADDLNALY
F7FUT7_BIK-01           VGGSDPEEDLDPVEDPLECMENSDALALQLACIADQMDVSLRARRLAQLY
F6XMC1_BCL2L11-01       RPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQG-----PLAPPASPGPF
F6XMC1_BCL2L11-09       RPGAPTSLQTEPQ-------------------------------------
F6XMC1_BCL2L11-02       RPGAPTSLQTEPQ-------------------------------------
F6XMC1_BCL2L11-03       RPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQG-----PLAPPASPGPF
F6XMC1_BCL2L11-08       RPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQG-----PLAPPASPGPF
F6XMC1_BCL2L11-05       RPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQG-----PLAPPASPGPF
F6XMC1_BCL2L11-07       RPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQG-----PLAPPASPGPF
F6XMC1_BCL2L11-06       RPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQG-----PLAPPASPGPF
F6XMC1_BCL2L11-04       RPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQG-----PLAPPASPGPF
F6SJL0_BAD-02           APGLPGDASHQQGQSTSSSHHGENPSVRMFSKASAGMSAPATDSEAQHTE
F6SJL0_BAD-01           APGLPGDASHQQGQSTSSSHHGGAGAVETRSRHS---SYPAGTEEDEGME
                                                                          

F7GW45_PMAIP1-01        ------------------------------------ARAPADLEVECATQ
U3E722_HRK-01           ------------------------------ALGDELHQRTMWRRRARSRR
F7HPK0_BMF-02           PTS-------------------------------QEDKATQTLSPASPSQ
F7HPK0_BMF-01           PTS-------------------------------QEDKATQTLSPASPSQ
A0A2R8MW85_BBC3-03      ERR---------------------------------------RQEEQPQH
F7FUT7_BIK-01           EVAMYSPGLAFVLDRTDIGDVLSGVVDVFANFQEDIVRLWRSLSSGSWVS
F6XMC1_BCL2L11-01       ATR--SPLFIFVRRSSVLSRSSSG------YFSFDTDRSPAPMSCDKSTQ
F6XMC1_BCL2L11-09       ------------------------------------DRSPAPMSCDKSTQ
F6XMC1_BCL2L11-02       ------------------------------------DRSPAPMSCDKSTQ
F6XMC1_BCL2L11-03       ATR--SPLFIFVRRSSVLSRSSSG------YFSFDTDRSPAPMSCDKSTQ
F6XMC1_BCL2L11-08       ATR--SPLFIFVRRSSVLSRSSSG------YFSFDTDRSPAPMSCDKSTQ
F6XMC1_BCL2L11-05       ATR--SPLFIFVRRSSVLSRSSSG------YFSFDTDRSPAPMSCDKSTQ
F6XMC1_BCL2L11-07       ATR--SPLFIFVRRSSVLSRSSSG------YFSFDTDRSPAPMSCDKSTQ
F6XMC1_BCL2L11-06       ATR--SPLFIFVRRSSVLSRSSSG------YFSFDTDRSPAPMSCDKSTQ
F6XMC1_BCL2L11-04       ATR--SPLFIFVRRSSVLSRSSSG------YFSFDTDRSPAPMSCDKSTQ
F6SJL0_BAD-02           NVK--LEALGLWRPGVATARTPQG-----RRRTKGWRRSPAPFGAVRAR-
F6SJL0_BAD-01           EEP--SPFRG--RSRSAPPNLWAA-----QRYGRELRRMSDEFVDSFKKG
                                                                          

F7GW45_PMAIP1-01        LRRFGDKLN-----------------FRQKLLNLISKLFCSGT-------
U3E722_HRK-01           APAPGALPT-----------------YWPWLCAAAQVAALAAWLLGRRNL
F7HPK0_BMF-02           GVMLPCGVTEEPQRLFYAPAE-----PKSHVVAGPPLPAQPGFEWR----
F7HPK0_BMF-01           GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAE
A0A2R8MW85_BBC3-03      RPSPWRVL------------------YNLIMGLLPFPRGHRAPEMEPN--
F7FUT7_BIK-01           RKQAVLLA------------------LLALLLAMFSGGLHLLLK------
F6XMC1_BCL2L11-01       TPSPPCQA------------------FNHYLSAMASMRQSQAEPAGMRPE
F6XMC1_BCL2L11-09       TPSPPCQA------------------FNHYLSAMVVIRMDIGDISLWFRF
F6XMC1_BCL2L11-02       TPSPPCQA------------------FNHYLSAMASMRQSQAEPAGMRPE
F6XMC1_BCL2L11-03       TPSPPCQA------------------FNHYLSAMASMRQSQAEPAGMRPE
F6XMC1_BCL2L11-08       TPSPPCQA------------------FNHYLSAMGYRLTGQQPCLPWKVR
F6XMC1_BCL2L11-05       TPSPPCQA------------------FNHYLSAMASMRQSQAEPAGMRPE
F6XMC1_BCL2L11-07       TPSPPCQA------------------FNHYLSAMASMRQSQAEPAGMRPE
F6XMC1_BCL2L11-06       TPSPPCQA------------------FNHYLSAMVREIEEVVV-------
F6XMC1_BCL2L11-04       TPSPPCQA------------------FNHYLSAM-----GIFE-------
F6SJL0_BAD-02           --HPPTSG------------------QHSAMAASS---------------
F6SJL0_BAD-01           LPRPKSAG------------------TATQMRQSSSWTRVIQS-------
                                                                          

F7GW45_PMAIP1-01        --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
F7HPK0_BMF-02           -------------------------REQEW--------------------
F7HPK0_BMF-01           VQIARKLQCIADQFHRLHVQQHQQNRNRMWWQVLLFLHNLALNGEENRNG
A0A2R8MW85_BBC3-03      --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
F6XMC1_BCL2L11-01       IWIAQELRRIGDEFNAYYPRRVNWILPFCHRKEVCLEAFPVLPSKASQSA
F6XMC1_BCL2L11-09       TFTFFDLCGHHHSQGTEQQHKDFSW-------------------------
F6XMC1_BCL2L11-02       IWIAQELRRIGDEFNAYYPRRVNWILPFCHRKEVCLEAFPVLPSKASQSA
F6XMC1_BCL2L11-03       IWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVW
F6XMC1_BCL2L11-08       GIGEKQEERVNPHTWETFKSTRTHSLSARNSIHP----------------
F6XMC1_BCL2L11-05       IWIAQELRRIGDEFNAYYPRRISLLPD-----------------------
F6XMC1_BCL2L11-07       IWIAQELRRIGDEFNAYYPRRLEK--------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
F6SJL0_BAD-02           ---------GG---------------------------------------
F6SJL0_BAD-01           -WWDRNLGRGGSAPSQ----------------------------------
                                                                          

F7GW45_PMAIP1-01        --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
F7HPK0_BMF-02           GRPE----------------------------------------------
F7HPK0_BMF-01           AGPR----------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
F6XMC1_BCL2L11-01       YWTTIRDRSINTCCAKAQRIISGNILQSVARWCQMMLTPQLYLVLKDGGP
F6XMC1_BCL2L11-09       --------------------------------------------------
F6XMC1_BCL2L11-02       YWTTIRDRSINTCCAKAQRIISGNILQSVARWCQMMLTPQLYLVLKDGGP
F6XMC1_BCL2L11-03       RMH-----------------------------------------------
F6XMC1_BCL2L11-08       --------------------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
F6SJL0_BAD-02           --------------------------------------------------
F6SJL0_BAD-01           --------------------------------------------------
                                                                          

F7GW45_PMAIP1-01        ----------------
U3E722_HRK-01           ----------------
F7HPK0_BMF-02           ----------------
F7HPK0_BMF-01           ----------------
A0A2R8MW85_BBC3-03      ----------------
F7FUT7_BIK-01           ----------------
F6XMC1_BCL2L11-01       VVKSALKLPWFHSPVA
F6XMC1_BCL2L11-09       ----------------
F6XMC1_BCL2L11-02       VVKSALKLPWFHSPVA
F6XMC1_BCL2L11-03       ----------------
F6XMC1_BCL2L11-08       ----------------
F6XMC1_BCL2L11-05       ----------------
F6XMC1_BCL2L11-07       ----------------
F6XMC1_BCL2L11-06       ----------------
F6XMC1_BCL2L11-04       ----------------
F6SJL0_BAD-02           ----------------
F6SJL0_BAD-01           ----------------
                                        

© 1998-2018