Dataset for protein Bmf of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7HPK0_BMF-02      MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
F7HPK0_BMF-01      MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
                   ************************************************************

F7HPK0_BMF-02      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAE-----PKSHVVAGPPLPAQ
F7HPK0_BMF-01      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQP
                   *************************************. *      * *. .. *     

F7HPK0_BMF-02      PGFEWR-----------------------------REQEW--------------------
F7HPK0_BMF-01      PEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRMWWQVLLFLHNLALNGEENRNG
                   *  :*.                             *:. *                    

F7HPK0_BMF-02      GRPE
F7HPK0_BMF-01      AGPR
                   . * 

© 1998-2018