Dataset for protein Bim of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6XMC1_BCL2L11-01      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
F6XMC1_BCL2L11-09      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
F6XMC1_BCL2L11-02      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
F6XMC1_BCL2L11-03      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
F6XMC1_BCL2L11-08      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
F6XMC1_BCL2L11-05      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
F6XMC1_BCL2L11-07      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
F6XMC1_BCL2L11-06      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
F6XMC1_BCL2L11-04      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                       *****************************************         

F6XMC1_BCL2L11-01      EGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
F6XMC1_BCL2L11-09      --------------------------------------------------
F6XMC1_BCL2L11-02      --------------------------------------------------
F6XMC1_BCL2L11-03      EGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
F6XMC1_BCL2L11-08      EGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
F6XMC1_BCL2L11-05      EGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
F6XMC1_BCL2L11-07      EGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
F6XMC1_BCL2L11-06      EGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
F6XMC1_BCL2L11-04      EGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
                                                                         

F6XMC1_BCL2L11-01      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWI
F6XMC1_BCL2L11-09      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVIRMDIGDISLWFRFTFT
F6XMC1_BCL2L11-02      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWI
F6XMC1_BCL2L11-03      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWI
F6XMC1_BCL2L11-08      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGYRLTGQQPCLPWKVRGIG
F6XMC1_BCL2L11-05      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWI
F6XMC1_BCL2L11-07      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWI
F6XMC1_BCL2L11-06      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------
F6XMC1_BCL2L11-04      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----GIFE----------
                        ******************************                   

F6XMC1_BCL2L11-01      AQELRRIGDEFNAYYPRRVNWILPFCHRKEVCLEAFPVLPSKASQSAYWT
F6XMC1_BCL2L11-09      FFDLCGHHHSQGTEQQHKDFSW----------------------------
F6XMC1_BCL2L11-02      AQELRRIGDEFNAYYPRRVNWILPFCHRKEVCLEAFPVLPSKASQSAYWT
F6XMC1_BCL2L11-03      AQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
F6XMC1_BCL2L11-08      EKQEERVNPHTWETFKSTRTHSLSARNSIHP-------------------
F6XMC1_BCL2L11-05      AQELRRIGDEFNAYYPRRISLLPD--------------------------
F6XMC1_BCL2L11-07      AQELRRIGDEFNAYYPRRLEK-----------------------------
F6XMC1_BCL2L11-06      --------------------------------------------------
F6XMC1_BCL2L11-04      --------------------------------------------------
                                                                         

F6XMC1_BCL2L11-01      TIRDRSINTCCAKAQRIISGNILQSVARWCQMMLTPQLYLVLKDGGPVVK
F6XMC1_BCL2L11-09      --------------------------------------------------
F6XMC1_BCL2L11-02      TIRDRSINTCCAKAQRIISGNILQSVARWCQMMLTPQLYLVLKDGGPVVK
F6XMC1_BCL2L11-03      --------------------------------------------------
F6XMC1_BCL2L11-08      --------------------------------------------------
F6XMC1_BCL2L11-05      --------------------------------------------------
F6XMC1_BCL2L11-07      --------------------------------------------------
F6XMC1_BCL2L11-06      --------------------------------------------------
F6XMC1_BCL2L11-04      --------------------------------------------------
                                                                         

F6XMC1_BCL2L11-01      SALKLPWFHSPVA
F6XMC1_BCL2L11-09      -------------
F6XMC1_BCL2L11-02      SALKLPWFHSPVA
F6XMC1_BCL2L11-03      -------------
F6XMC1_BCL2L11-08      -------------
F6XMC1_BCL2L11-05      -------------
F6XMC1_BCL2L11-07      -------------
F6XMC1_BCL2L11-06      -------------
F6XMC1_BCL2L11-04      -------------
                                    

© 1998-2018