Dataset for protein Bad of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6SJL0_BAD-01      MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHRRQAPGLPGDASHQQGQSTSSSH
F6SJL0_BAD-02      MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHRRQAPGLPGDASHQQGQSTSSSH
                   ************************************************************

F6SJL0_BAD-01      HGGAGAVETRSRHS---SYPAGTEEDEGMEEEPSPFRG--RSRSAPPNLWAAQRYGRELR
F6SJL0_BAD-02      HGENPSVRMFSKASAGMSAPATDSEAQHTENVKLEALGLWRPGVATARTPQGRRRTKGWR
                   **   :*   *. *   * **  .* :  *:      *  *.  *...   ..*  .  *

F6SJL0_BAD-01      RMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVIQSWWDRNLGRGGSAPSQ
F6SJL0_BAD-02      RSPAPFGAVRAR---HPPTSGQHSAMAASS----------------GG-----
                   * .  *     .   .* ::*  : *  **                **     

© 1998-2018