Dataset for protein classical BH3-containing proteins of organism Caenorhabditis remanei

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E3MP30_EGL1-01      MLSLL---------------CDFVKPFYSNNFKNMMFFDF-HTSSLHAVTSSEFAEDSGF
E3LTJ5_EGL1-01      MLTFASSSSSDLFLSMPNSHFDIVKPFCCINEKKIMCSDYCNTSSDDASTSSEFADDSGF
E3M1A5_EGL1-01      MLTFA--SSSDLLISMPSSHYDFVKPFY--SNKNMLFSDF-PTSSDHAVTSSEFADDSEF
                    **::                 *:****   . *:::  *:  ***  * ******:** *

E3MP30_EGL1-01      LDSSKTSHYIHERSKEIGTKLTTMCDGFDAKMMSYSRSESTSRSLLGRFYDFFAF
E3LTJ5_EGL1-01      FDDSETDDYITKTAYEIGTKLVAMCDDFDAQMMSYSRT-VPSRSILSRVFDFFAF
E3M1A5_EGL1-01      FDSSETSHYIHEISQEIGTKLAAMCDDFDAKMMSYSRSGSTSRSLLGRFLDFFAF
                    :*.*:*. ** : : ******.:***.***:******:  .***:*.*. *****

© 1998-2018