Dataset for protein classical BH3-containing proteins of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q05KI3_BMF-02          ------------------------------------MEPPQCVEELEDDV
Q05KI3_BMF-01          ------------------------------------MEPPQCVEELEDDV
F1MUT9_BAD-01          --------------------------MFQIPEFEQSEQEDSSPADRGLGP
Q3SYZ0_BAD-01          --------------------------MFQIPEFEQSEQEDSSRADRGLGP
Q2YDF0_BCL2L11-02      --------------------------------MAKQPSDVSSECDREGGQ
Q2YDF0_BCL2L11-03      --------------------------------MAKQPSDVSSECDREGGQ
Q2YDF0_BCL2L11-01      MPLSVRSYLWIWLGSPGAGLGDLAPIRRKKDQMAKQPSDVSSECDREGGQ
                                                            .  ..  :   . 

Q05KI3_BMF-02          FQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTS
Q05KI3_BMF-01          FQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTS
F1MUT9_BAD-01          SPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGS----------------
Q3SYZ0_BAD-01          SPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGS----------------
Q2YDF0_BCL2L11-02      LQPAERPPQLRP---GAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPAS
Q2YDF0_BCL2L11-03      LQPAERPPQLRP---GAPTSLQTERQ------------------------
Q2YDF0_BCL2L11-01      LQPAERPPQLRP---GAPTSLQTERQ------------------------
                         . :  *        :.  :                             

Q05KI3_BMF-02          QE------------------------------DKATQTLSPASPSQGVML
Q05KI3_BMF-01          QE------------------------------DKATQTLSPASPSQGVML
F1MUT9_BAD-01          --------------------------------SHHGGTGAVETRSRHSSY
Q3SYZ0_BAD-01          --------------------------------SHHGGTGAVETRSRHSSY
Q2YDF0_BCL2L11-02      PGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSP
Q2YDF0_BCL2L11-03      --------------------------------DRSPAPMSCDKSTQTPSP
Q2YDF0_BCL2L11-01      --------------------------------DRSPAPMSCDKSTQTPSP
                                                       ..   . :  . :.    

Q05KI3_BMF-02          PCGVTEEPQRLFYGHAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIA
Q05KI3_BMF-01          PCGVTEEPQRLFYGHAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIA
F1MUT9_BAD-01          RAGPED-----------NEETEEEDLGPFRGRSRSAPPNLWAAQ---RYG
Q3SYZ0_BAD-01          RAGPED-----------NEETEEEDLGPFRGRSRSAPPNLWAAQ---RYG
Q2YDF0_BCL2L11-02      PCQAFN-----------HYLSAMASMRQSQAVPADTRPEIWIAQ------
Q2YDF0_BCL2L11-03      PCQAFN-----------HYLSAMASMRQSQAVPADTRPEIWIAQ------
Q2YDF0_BCL2L11-01      PCQAFN-----------HYLSAMASMRQSQAVPADTRPEIWIAQ------
                        .   :              .   .:        ..    *  .      

Q05KI3_BMF-02          RKLQCIADQFHRLH----------MQQYQQNRNRMWWQILLFLHNVALNG
Q05KI3_BMF-01          RKLQCIADQFHRLH----------MQQYQQNRNRMWWQILLFLHNVALNG
F1MUT9_BAD-01          RELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRG
Q3SYZ0_BAD-01          RELRRMSDEFHVSFKGLPRPKSAGTATEMRQSPSWTRFLQSWLSRNLGRG
Q2YDF0_BCL2L11-02      -ELRRIGDEFNAYY---PRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRM
Q2YDF0_BCL2L11-03      -ELRRIGDEFNAYY---PRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRM
Q2YDF0_BCL2L11-01      -ELRRIGDEFNAYY---PRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRM
                        :*. :.*:*:  .                :       :  :: .   . 

Q05KI3_BMF-02          DENRNGAGPR
Q05KI3_BMF-01          DENRNGAGPR
F1MUT9_BAD-01          GSAPSQ----
Q3SYZ0_BAD-01          GSAPSQ----
Q2YDF0_BCL2L11-02      Q---------
Q2YDF0_BCL2L11-03      Q---------
Q2YDF0_BCL2L11-01      Q---------
                                 

© 1998-2019