Dataset for protein classical BH3-containing proteins of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3MWR6_HRK-01          --------------------------------------------MCPCPL
Q2YDF0_BCL2L11-01      ------MAKQPSDVSSECDREGGQLQPAERPPQLRPG---APTSL-QTER
Q05KI3_BMF-01          -MEPPQCVEELEDDVFQPEDG----EPGTQPRSLLSADLFAQSQL-DCPL
F1MUT9_BAD-01          MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGH
Q3SYZ0_BAD-01          MFQIPEFEQSEQEDSSRADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGH
                                                                   :     

G3MWR6_HRK-01          HRGRGPPAVCACSAG---------------RLGLRSS-------------
Q2YDF0_BCL2L11-01      QDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVP---------
Q05KI3_BMF-01          SRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQR
F1MUT9_BAD-01          QQGQPAGSSHHGGTG----AVETRSRHSSYRAGPEDNE----ETEEEDLG
Q3SYZ0_BAD-01          QQGQPAGSSHHGGTG----AVETRSRHSSYRAGPEDNE----ETEEEDLG
                                   ..                  .  ..             

G3MWR6_HRK-01          ----------------------------------AAQLTAARLKALGDEL
Q2YDF0_BCL2L11-01      -----------------------ADTRPEIW-------IAQELRRIGDEF
Q05KI3_BMF-01          LFYGHAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQF
F1MUT9_BAD-01          PFRGRS-----------------RSAPPNLW---AAQRYGRELRRMSDEF
Q3SYZ0_BAD-01          PFRGRS-----------------RSAPPNLW---AAQRYGRELRRMSDEF
                                                              .  *. :.*::

G3MWR6_HRK-01          HQRTMWRRRARSRRAPASGALPTYWPWLCAAAQVAALAAWLLGRRNL---
Q2YDF0_BCL2L11-01      NAYYP--RRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ----------
Q05KI3_BMF-01          H---------RLHMQQYQQNRNRMWWQILLFLHNVALNGDENRNGAGPR-
F1MUT9_BAD-01          HVSFKGLPRPKSAGTATQMRQSPSWTRFL----QSWLSRNLGRGGSAPSQ
Q3SYZ0_BAD-01          HVSFKGLPRPKSAGTATEMRQSPSWTRFL----QSWLSRNLGRGGSAPSQ
                       :                .        ..                      

© 1998-2018