Dataset for protein classical BH3-containing proteins of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
Q05KI3_BMF-01           ------------------------------------MEPPQCVEELEDDV
Q05KI3_BMF-02           ------------------------------------MEPPQCVEELEDDV
A0A3Q1LXZ6_BBC3-01      ---------------------------------MARARQEGSSPEPVEGL
F1MUT9_BAD-01           --------------------------MFQIPEFEQSEQEDSSPADRGLGP
Q3SYZ0_BAD-01           --------------------------MFQIPEFEQSEQEDSSRADRGLGP
Q2YDF0_BCL2L11-02       --------------------------------MAKQPSDVSSECDREGGQ
Q2YDF0_BCL2L11-03       --------------------------------MAKQPSDVSSECDREGGQ
Q2YDF0_BCL2L11-01       MPLSVRSYLWIWLGSPGAGLGDLAPIRRKKDQMAKQPSDVSSECDREGGQ
                                                                          

A0A3Q1NFP6_PMAIP1-      -MPGRR--------------------------------------------
Q05KI3_BMF-01           FQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTS
Q05KI3_BMF-02           FQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTS
A0A3Q1LXZ6_BBC3-01      ARDGPRPFPLSR---LVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTA
F1MUT9_BAD-01           SPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGS----------------
Q3SYZ0_BAD-01           SPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGS----------------
Q2YDF0_BCL2L11-02       LQPAERPPQLRP---GAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPAS
Q2YDF0_BCL2L11-03       LQPAERPPQLRP---GAPTSLQTERQ------------------------
Q2YDF0_BCL2L11-01       LQPAERPPQLRP---GAPTSLQTERQ------------------------
                                                                          

A0A3Q1NFP6_PMAIP1-      --------------------------------ARKSAQPSPTRVPADPEV
Q05KI3_BMF-01           QE------------------------------DKATQTLSPASPSQGVML
Q05KI3_BMF-02           QE------------------------------DKATQTLSPASPSQGVML
A0A3Q1LXZ6_BBC3-01      PPAVTAALGAPRW-------------------PGGPRSRPRGPRPDGPQP
F1MUT9_BAD-01           --------------------------------SHHGGTGAVETRSRHSSY
Q3SYZ0_BAD-01           --------------------------------SHHGGTGAVETRSRHSSY
Q2YDF0_BCL2L11-02       PGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSP
Q2YDF0_BCL2L11-03       --------------------------------DRSPAPMSCDKSTQTPSP
Q2YDF0_BCL2L11-01       --------------------------------DRSPAPMSCDKSTQTPSP
                                                               .    .     

A0A3Q1NFP6_PMAIP1-      ECAI----------------------------------------------
Q05KI3_BMF-01           PCGVTEEPQRLFYGHAGYRLPLPASFPAGLPLGEQPPE----GQWQHRAE
Q05KI3_BMF-02           PCGVTEEPQRLFYGHAGYRLPLPASFPAGLPLGEQPPE----GQWQHRAE
A0A3Q1LXZ6_BBC3-01      SLSPAEQ-------HLESPVPSAPGALAGGPTQAAPGVRGEEEQWARE--
F1MUT9_BAD-01           RAGPEDN-------EETE--EEDLGPFRGRSRSAPPNL------WAAQ--
Q3SYZ0_BAD-01           RAGPEDN-------EETE--EEDLGPFRGRSRSAPPNL------WAAQ--
Q2YDF0_BCL2L11-02       PCQAFNH-------YLSA--MASMRQSQAVPADTRPEI------WIAQ--
Q2YDF0_BCL2L11-03       PCQAFNH-------YLSA--MASMRQSQAVPADTRPEI------WIAQ--
Q2YDF0_BCL2L11-01       PCQAFNH-------YLSA--MASMRQSQAVPADTRPEI------WIAQ--
                                                                          

A0A3Q1NFP6_PMAIP1-      -----QLRRIGDKLNFRQ-----------------------KLVNLISKL
Q05KI3_BMF-01           IQIARKLQCIADQFHRLH--------MQQYQQNRNRMWWQILLFLHNVAL
Q05KI3_BMF-02           IQIARKLQCIADQFHRLH--------MQQYQQNRNRMWWQILLFLHNVAL
A0A3Q1LXZ6_BBC3-01      --IGAQLRRMADDLNALY---ERRRQEERQRHRPSPWRVLYNLIMGLLPF
F1MUT9_BAD-01           -RYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRN
Q3SYZ0_BAD-01           -RYGRELRRMSDEFHVSFKGLPRPKSAGTATEMRQSPSWTRFLQSWLSRN
Q2YDF0_BCL2L11-02       -----ELRRIGDEFNAYY---PRRVFVRHQAVEGHPQMVLLRVLRYIVRL
Q2YDF0_BCL2L11-03       -----ELRRIGDEFNAYY---PRRVFVRHQAVEGHPQMVLLRVLRYIVRL
Q2YDF0_BCL2L11-01       -----ELRRIGDEFNAYY---PRRVFVRHQAVEGHPQMVLLRVLRYIVRL
                             :*. :.*.::                           :       

A0A3Q1NFP6_PMAIP1-      LRSGT-------
Q05KI3_BMF-01           NGDENRNGAGPR
Q05KI3_BMF-02           NGDENRNGAGPR
A0A3Q1LXZ6_BBC3-01      PGGRGAPEVEPN
F1MUT9_BAD-01           LGRGGSAPSQ--
Q3SYZ0_BAD-01           LGRGGSAPSQ--
Q2YDF0_BCL2L11-02       VWRMQ-------
Q2YDF0_BCL2L11-03       VWRMQ-------
Q2YDF0_BCL2L11-01       VWRMQ-------
                                    

© 1998-2019