Dataset for protein Bmf of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q05KI3_BMF-01      MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGL
Q05KI3_BMF-02      MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGL
                   ************************************************************

Q05KI3_BMF-01      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGHAGYRLPLPASFPAGLPLGEQP
Q05KI3_BMF-02      RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGHAGYRLPLPASFPAGLPLGEQP
                   ************************************************************

Q05KI3_BMF-01      PEGQWQHRAEIQIARKLQCIADQFHRLHMQQYQQNRNRMWWQILLFLHNVALNGDENRNG
Q05KI3_BMF-02      PEGQWQHRAEIQIARKLQCIADQFHRLHMQQYQQNRNRMWWQILLFLHNVALNGDENRNG
                   ************************************************************

Q05KI3_BMF-01      AGPR
Q05KI3_BMF-02      AGPR
                   ****

© 1998-2019