Dataset for protein Bim of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q2YDF0_BCL2L11-02      --------------------------------MAKQPSDVSSECDREGGQ
Q2YDF0_BCL2L11-03      --------------------------------MAKQPSDVSSECDREGGQ
Q2YDF0_BCL2L11-01      MPLSVRSYLWIWLGSPGAGLGDLAPIRRKKDQMAKQPSDVSSECDREGGQ
                                                       ******************

Q2YDF0_BCL2L11-02      LQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGP
Q2YDF0_BCL2L11-03      LQPAERPPQLRPGAPTSLQTERQ---------------------------
Q2YDF0_BCL2L11-01      LQPAERPPQLRPGAPTSLQTERQ---------------------------
                       ***********************                           

Q2YDF0_BCL2L11-02      FATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ
Q2YDF0_BCL2L11-03      -----------------------------DRSPAPMSCDKSTQTPSPPCQ
Q2YDF0_BCL2L11-01      -----------------------------DRSPAPMSCDKSTQTPSPPCQ
                                                    *********************

Q2YDF0_BCL2L11-02      AFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVR
Q2YDF0_BCL2L11-03      AFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVR
Q2YDF0_BCL2L11-01      AFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVR
                       **************************************************

Q2YDF0_BCL2L11-02      HQAVEGHPQMVLLRVLRYIVRLVWRMQ
Q2YDF0_BCL2L11-03      HQAVEGHPQMVLLRVLRYIVRLVWRMQ
Q2YDF0_BCL2L11-01      HQAVEGHPQMVLLRVLRYIVRLVWRMQ
                       ***************************

© 1998-2019