Dataset for protein Bad of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F1MUT9_BAD-01      MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSH
Q3SYZ0_BAD-01      MFQIPEFEQSEQEDSSRADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSH
                   **************** *******************************************

F1MUT9_BAD-01      HGGTGAVETRSRHSSYRAGPEDNEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSD
Q3SYZ0_BAD-01      HGGTGAVETRSRHSSYRAGPEDNEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSD
                   ************************************************************

F1MUT9_BAD-01      EFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ
Q3SYZ0_BAD-01      EFHVSFKGLPRPKSAGTATEMRQSPSWTRFLQSWLSRNLGRGGSAPSQ
                   *******************:****************************

© 1998-2018