Dataset for protein classical BH3-containing proteins of organism Bos mutus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


L8IXF5_BMF-01          --MEPPQCVEELEDD--VFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSR
L8IVA4_BCL2L11-02      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDR
L8IVA4_BCL2L11-01      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQ---------
                          :*.:  .* : :   :** :  *  .* :  * :   *         

L8IXF5_BMF-01          LQLFPLTHCCGPGLRPTSQE---------------------------DKA
L8IVA4_BCL2L11-02      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
L8IVA4_BCL2L11-01      -----------------------------------------------DRS
                                                                      *.:

L8IXF5_BMF-01          TQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQ
L8IVA4_BCL2L11-02      PAPMSCDKSTQTPSPPCQAFN-----HYLSAMASMRQSQAVPA-------
L8IVA4_BCL2L11-01      PAPMSCDKSTQTPSPPCQAFN-----HYLSAMASMRQSQAVPA-------
                       . .:*  ..:*    ** . :     .* .*   :  . :.**       

L8IXF5_BMF-01          PPEGQWQHRAEIQIARKLQCIADQFHR-------LHMQQYQQNRNRMWWQ
L8IVA4_BCL2L11-02      ------DTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLR
L8IVA4_BCL2L11-01      ------DTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLR
                             : *.**.**.:*. *.*:*:        :. *  : : : :  .

L8IXF5_BMF-01          ILLFLHNVALNGDENRNGAGPR
L8IVA4_BCL2L11-02      VLRYIVRLVWRMQ---------
L8IVA4_BCL2L11-01      VLRYIVRLVWRMQ---------
                       :* :: .:. . :         

© 1998-2019