Dataset for protein Bim of organism Bos mutus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


L8IVA4_BCL2L11-02      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDR
L8IVA4_BCL2L11-01      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQ---------
                       *****************************************         

L8IVA4_BCL2L11-02      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
L8IVA4_BCL2L11-01      -----------------------------------------------DRS
                                                                      ***

L8IVA4_BCL2L11-02      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQEL
L8IVA4_BCL2L11-01      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQEL
                       **************************************************

L8IVA4_BCL2L11-02      RRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ
L8IVA4_BCL2L11-01      RRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ
                       *********************************************

© 1998-2019