Dataset for protein classical BH3-containing proteins of organism Astyanax mexicanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B1IH05_BAD-01       ----------------------MSTAARAAAGTCD---------------
A0A3B1JLM2_BAD-01       MSNQYLLKLRRARFNCDEEGYSQALNSRTSTEGGG---------------
A0A3B1JXK6_BCL2L11      --------MSRPSNRATRPPFLKEQGERGQSGGGGGTLSRAEQCEQPEPG
                                                                          

A0A3B1K1X5_BMF-01       -----------------------------MDDEEDDVFVTDPEPWRSPI-
A0A3B1IH05_BAD-01       --------------------STAVSQPSKLDFTMDHMFTISDESDASEE-
A0A3B1JLM2_BAD-01       --------------------RDTLFRPLCWNSSGSTVFTMEKTPPHSKED
A0A3B1JXK6_BCL2L11      DGDPVRGPPALHNSLLGYQTRSPLFRTLSRSSSGYFSFDSEPSSP-----
                                                      .      *  .  .      

A0A3B1K1X5_BMF-01       --------------SVIKQEERGTQTPGRPPARTNGMLPCGISEEPRRLF
A0A3B1IH05_BAD-01       ----LGDSDQPEVSKTAEPSRSGQHITVPE-----------------KLR
A0A3B1JLM2_BAD-01       DISPIDDHDESRWSEAVKSVDSPQTDSGPSMYRDTSSDELLEVGGRVRLY
A0A3B1JXK6_BCL2L11      ----------------LLMHSASTQTPSPS--------------------
                                                  .                       

A0A3B1K1X5_BMF-01       YGSAGLLLLAPSARSERVGDAMFREEHRAVEPRRRPAHSVEARI------
A0A3B1IH05_BAD-01       VEPRQRNFSMNEEALQESGAGRHEDGARDGDSFRRRSRSAPPSLWAAKKY
A0A3B1JLM2_BAD-01       SESQVYNINRWEDNENQDGASAEDGGVGDGAPFRGRSQSAPAALWKAKKY
A0A3B1JXK6_BCL2L11      SQVIIHALQRISEARGDAQSFELCPGPNHCPPHRAAAAGDMQAHWYI---
                               :   .                   . *  : .           

A0A3B1K1X5_BMF-01       GQKLQMIGDQFYQEHMLQHRNQR---NQQPLWLRLASALYTLLFEREPAA
A0A3B1IH05_BAD-01       GRQLRKMSDEF--DKGLEQGMKRVRSAGAARQMQNSPSWFAFLWSHKESD
A0A3B1JLM2_BAD-01       GRQLRRMSDEF--DTWLDKGDLR---RTTGPGRHTNRGWFSFLW-GTKEE
A0A3B1JXK6_BCL2L11      AQELRRIGDEF--NDLYFRGAGR---NGGGAQLPAQNEPAFILWMGLLIE
                        ..:*. :.*:*  :    .   *                  :*:      

A0A3B1K1X5_BMF-01       HGRREDRR--
A0A3B1IH05_BAD-01       SEASSSRPAE
A0A3B1JLM2_BAD-01       EGRE------
A0A3B1JXK6_BCL2L11      RLRQFLHRRR
                                  

© 1998-2019