Dataset for protein classical BH3-containing proteins of organism Astyanax mexicanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


W5KM88_BMF-01      MCAFVFVYTFSGQECPDVGKAKSYLFWTSNVGTKLRWGAWKALLMDDEEDDVFVTDPEPW
W5KIV3_BAD-01      ------------------------------------------------------------
W5KW69_BAD-01      ------------------------------------MDHMFTISDESDASEELGDSDQPE
                                                                               

W5KM88_BMF-01      RSPISVIKQEERGTQTPGRPPARTNGMLPCGISEEPRRLFYGSAGLLLLAPSARSERVGD
W5KIV3_BAD-01      ----------------GGRVRLYS--------ESQVYNINRWEDNENQDGASAEDGGVGD
W5KW69_BAD-01      VSKTAEPSRSGQHITVPEKLRGES--------VSRQRNFSMNEEDLQESGAGRHEDGARD
                                     .    :         .   .:   . .    ...  .  . *

W5KM88_BMF-01      AMFREEHRAVEPRRRPAHSVEARIGQKLQMIGDQFYQEHMLQHRNQR----------NQQ
W5KIV3_BAD-01      G---APFRGRSQSAPAALWKAKKYGRQLRRMSDEF--DTWLDKGDLR-RTTGPGR--HTN
W5KW69_BAD-01      G---DSFRRRSRSAPPSLWAAKKYGRQLRKMSDEF--DKGLEQGMKRVRSAGAARQMQNS
                   .     .*  .    .:     . *.:*. :.*:*  :  *::   *          : .

W5KM88_BMF-01      PLWLRLASALYTLLFEREPAAHGRREDRR--
W5KIV3_BAD-01      RGW-------FSFLWGTKEEEGRE-------
W5KW69_BAD-01      PSW-------FAFLWSHKESDSEASSSRPAE
                     *       :::*:  :             

© 1998-2018