Dataset for protein Bad of organism Astyanax mexicanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


W5KIV3_BAD-01      ----------------------------------------GGRVRLYSESQVYNINRWED
W5KW69_BAD-01      MDHMFTISDESDASEELGDSDQPEVSKTAEPSRSGQHITVPEKLRGESVSRQRNFSMNEE
                                                             .:*  * *.  *:. .*:

W5KIV3_BAD-01      NENQDGASAEDGGVGDGAPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGDLR-R
W5KW69_BAD-01      DLQESGAGRHEDGARDGDSFRRRSRSAPPSLWAAKKYGRQLRKMSDEFDKGLEQGMKRVR
                   : ::.**.  :.*. ** .** **.***.:** *********.******. *::*  * *

W5KIV3_BAD-01      TTGPGR--HTNRGWFSFLWGTKEEEGRE-------
W5KW69_BAD-01      SAGAARQMQNSPSWFAFLWSHKESDSEASSSRPAE
                   ::*..*  :.. .**:***. **.:.         

© 1998-2018