Dataset for protein Bad of organism Astyanax mexicanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B1IH05_BAD-01      ----------------------MSTAARAAAGTCDSTAVSQPSKLDFTMD
A0A3B1JLM2_BAD-01      MSNQYLLKLRRARFNCDEEGYSQALNSRTSTEGGGRDTLFRPLCWNSSGS
                                              :  :*:::   .  :: .*   : : .

A0A3B1IH05_BAD-01      HMFTIS-----------------DESDASEELGDSDQPEVSKTAEPSR--
A0A3B1JLM2_BAD-01      TVFTMEKTPPHSKEDDISPIDDHDESRWSEAVKSVDSPQTDSGPSMYRDT
                        :**:.                 ***  ** : . *.*:... ..  *  

A0A3B1IH05_BAD-01      -SGQHITVPEKLRVEPRQRNFSMN--EEALQESGAGRHEDGARDGDSFRR
A0A3B1JLM2_BAD-01      SSDELLEVGGRVRLYSESQVYNINRWEDNENQDGASAEDGGVGDGAPFRG
                        *.: : *  .:*: . .. :.:*  *:  ::.**.  :.*. ** .** 

A0A3B1IH05_BAD-01      RSRSAPPSLWAAKKYGRQLRKMSDEFDKGLEQGMKRVRSAGAARQMQNSP
A0A3B1JLM2_BAD-01      RSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGDLR-RTTGPGR--HTNR
                       **.***.:** *********.******. *::*  * *::*..*  :.. 

A0A3B1IH05_BAD-01      SWFAFLWSHKESDSEASSSRPAE
A0A3B1JLM2_BAD-01      GWFSFLWGTKEEEGRE-------
                       .**:***. **.:.         

© 1998-2019