Dataset for protein Bmf of organism Astatotilapia calliptera

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8NFE2_BMF-02      MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAE
A0A3P8NFE2_BMF-01      MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAE
                       **************************************************

A0A3P8NFE2_BMF-02      EPRPLFYGNAGFRLHFPARFELVGDHRASRQGSTEQQNSMERLPRQRPAA
A0A3P8NFE2_BMF-01      EPRPLFYGNAGFRLHFPARFELVGDHRASRQGSTEQQNSMERLPRQRPAA
                       **************************************************

A0A3P8NFE2_BMF-02      RSVEACIGQKLQLIGDQFHWERLQLVKASRIQT--CWLETAEAYATPCKV
A0A3P8NFE2_BMF-01      RSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWW----------RL
                       ************************* : .. :    *           .:

A0A3P8NFE2_BMF-02      HHSVITVWKPRGLSQWQFLTVN------
A0A3P8NFE2_BMF-01      AAAILSLLFDRG-----FIAGGGGGGRR
                         :::::   **     *:: .      

© 1998-2019