Dataset for protein classical BH3-containing proteins of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5E1W9_BMF-02       --------MEPSQCVEELEDDVFQSEDGE--------PGTQPGSLLSADL
A0A2K5F6X4_BBC3-02      -----------------------KCGVGS--------AWACP--------
A0A2K5BYA0_HRK-01       MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQ-------------------
A0A2K5CLG5_BIK-01       -------MSEVRPLSSDILMETLLCEQFVHP-------------------
A0A2K5E1W9_BMF-01       --------MEPSQCVEELEDDVFQSEDGE--------PGTQPGSLLSADL
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPG-------
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPG-------
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPG-------
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPG-------
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPG-------
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPG-------
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPG-------
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPG-------
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPG-------
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPG-------
A0A2K5E6K7_BAD-01       MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHPRQAPG-------
A0A2K5E6K7_BAD-03       MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHPRQAPG-------
A0A2K5E6K7_BAD-02       MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHPRQAPG-------
                                                                          

A0A2K5CFK7_PMAIP1-      -------MPGKKARKSAQPSP-----------------------------
A0A2K5E1W9_BMF-02       FAQSLLDCPLSRLQLFPLTHCCGP--------------------------
A0A2K5F6X4_BBC3-02      -------CQVPRASSSTWVPCQMC--------------------------
A0A2K5BYA0_HRK-01       -------LTAARLKALGD--------------------------------
A0A2K5CLG5_BIK-01       ----------LTMEVVGGSDPEEDL-------------------------
A0A2K5E1W9_BMF-01       FAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQE------------------
A0A2K5CAB2_BCL2L11      -------AP-TSLQTEPQ--------------------------------
A0A2K5CAB2_BCL2L11      -------AP-TSLQTEPQ--------------------------------
A0A2K5CAB2_BCL2L11      -------AP-TSLQTEPQ--------------------------------
A0A2K5CAB2_BCL2L11      -------AP-TSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K5CAB2_BCL2L11      -------AP-TSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K5CAB2_BCL2L11      -------AP-TSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K5CAB2_BCL2L11      -------AP-TSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K5CAB2_BCL2L11      -------AP-TSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K5CAB2_BCL2L11      -------AP-TSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K5CAB2_BCL2L11      -------AP-TSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K5E6K7_BAD-01       -------LPGDASHQQGQPTSSSHHGGAGAVETRSRH-------------
A0A2K5E6K7_BAD-03       -------LPGDASHQQGQPTSSSHHGGEYSTCASASS-------------
A0A2K5E6K7_BAD-02       -------LPGDASHQQGQPTSSSHHGGTSSPEERGHS-------------
                                                                          

A0A2K5CFK7_PMAIP1-      ----------------------------SRAPADLEVECATQ--------
A0A2K5E1W9_BMF-02       ----------------------------GLRPT-SQEDKATQTLSPASPS
A0A2K5F6X4_BBC3-02      ----------------------------GPQPSLSLAEQHLESPVPSAPG
A0A2K5BYA0_HRK-01       ----------------------------ELHQRTMWRRRARSRRAPAPGA
A0A2K5CLG5_BIK-01       ----------------------------DPVEDPLECMENSDALVLQLAC
A0A2K5E1W9_BMF-01       ----------------------------DKATQTLSPASPSQGVMLPCGV
A0A2K5CAB2_BCL2L11      ----------------------------DRSPAPMSCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      ----------------------------DRSPAPMSCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      ----------------------------DRSPAPMSCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      ATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      ATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      ATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      ATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      ATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      ATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      ATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K5E6K7_BAD-01       ----------------------------SSYPAGTEEDEGMEEEPSPFRG
A0A2K5E6K7_BAD-03       ----------------------------SENPSARMLSKASAGMSAPATD
A0A2K5E6K7_BAD-02       ----------------------------NADAAKLQLDASHPVLVGSELG
                                                                          

A0A2K5CFK7_PMAIP1-      -------------------------------------LRRFGDKLNFRQK
A0A2K5E1W9_BMF-02       QGVMLPCGVTEEPQRLFYASAEPKSRVVAGPPLSAQPGFEWRREQEWGR-
A0A2K5F6X4_BBC3-02      --------------------------ALAGGPTQAAPGVR-GEEEQWARE
A0A2K5BYA0_HRK-01       LPTYWPWLCAAA---------------QVAALAAWLLGRR---NL-----
A0A2K5CLG5_BIK-01       IADQMDVSLRAR---------RLAQLYEVAMYSPGLAFIL---DRTDIGD
A0A2K5E1W9_BMF-01       TEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHR---AEVQIAR
A0A2K5CAB2_BCL2L11      FNHYLSAMDEAT---------------ESSLGIA---LRR---EVQWPLE
A0A2K5CAB2_BCL2L11      FNHYLSAMGDISLWFRFIFTFFDLYGHHHSQGTE---QLH---HKYFS--
A0A2K5CAB2_BCL2L11      FNHYLSAMASMR---------------QSQAEPA---GMR---PEIWIAQ
A0A2K5CAB2_BCL2L11      FNHYLSAMVREI---------------EEVVV------------------
A0A2K5CAB2_BCL2L11      FNHYLSAMADWD--------------------------------------
A0A2K5CAB2_BCL2L11      FNHYLSAMGIFE--------------------------------------
A0A2K5CAB2_BCL2L11      FNHYLSAMASMR---------------QSQAEPA---GMR---PEIWIAQ
A0A2K5CAB2_BCL2L11      FNHYLSAMASMR---------------QSQAEPA---GMR---PEIWIAQ
A0A2K5CAB2_BCL2L11      FNHYLSAMASMR---------------QSQAEPA---GMR---PEIWIAQ
A0A2K5CAB2_BCL2L11      FNHYLSAMASMR---------------QSQAEPA---GMR---PEIWIAQ
A0A2K5E6K7_BAD-01       RSR---------------------------SAPP---NLW---AAQRYGR
A0A2K5E6K7_BAD-03       SENVKLEVPCWV---------------ATAPTPQ--------------GR
A0A2K5E6K7_BAD-02       QGRLRSLPVTFA---------------PHPETPPVPIALG---GHLGYGR
                                                                          

A0A2K5CFK7_PMAIP1-      LLNLISKLFCSGT-------------------------------------
A0A2K5E1W9_BMF-02       --------------------------------------------------
A0A2K5F6X4_BBC3-02      IGAQLRRMADDLNAQYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHR
A0A2K5BYA0_HRK-01       --------------------------------------------------
A0A2K5CLG5_BIK-01       VLSGIVEVFANFQEDIVRLWRSLSSGSWVSRKQAVLLALLALLLAMFSGG
A0A2K5E1W9_BMF-01       KLQCIADQFHRLHVQQ--------HQQNRNRVWWQVLLFLHNLALNGEEN
A0A2K5CAB2_BCL2L11      WLAKSS--------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      ELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH--
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      ELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH--
A0A2K5CAB2_BCL2L11      ELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH--
A0A2K5CAB2_BCL2L11      ELRRIGDEFNAYYPRRLEK-------------------------------
A0A2K5CAB2_BCL2L11      ELRRIGDEFNAYYPRRISLPSD----------------------------
A0A2K5E6K7_BAD-01       ELRRMSDEFVDSFKGL--PRPKSAGTATQMRQSSSWTQVIQSWWDRNLGR
A0A2K5E6K7_BAD-03       RRTKGWRRSPAPFGAVRAQHPPTSGQHSAMAASSGG--------------
A0A2K5E6K7_BAD-02       KCFLQGELTQIPFRCV----------------------------------
                                                                          

A0A2K5CFK7_PMAIP1-      -------
A0A2K5E1W9_BMF-02       -----PE
A0A2K5F6X4_BBC3-02      APEMEPN
A0A2K5BYA0_HRK-01       -------
A0A2K5CLG5_BIK-01       LHLLLK-
A0A2K5E1W9_BMF-01       RNGAGPR
A0A2K5CAB2_BCL2L11      -------
A0A2K5CAB2_BCL2L11      -------
A0A2K5CAB2_BCL2L11      -------
A0A2K5CAB2_BCL2L11      -------
A0A2K5CAB2_BCL2L11      -------
A0A2K5CAB2_BCL2L11      -------
A0A2K5CAB2_BCL2L11      -------
A0A2K5CAB2_BCL2L11      -------
A0A2K5CAB2_BCL2L11      -------
A0A2K5CAB2_BCL2L11      -------
A0A2K5E6K7_BAD-01       GGSAPSQ
A0A2K5E6K7_BAD-03       -------
A0A2K5E6K7_BAD-02       -------
                               

© 1998-2018