Dataset for protein classical BH3-containing proteins of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5CFK7_PMAIP1-      -------------------------MPGKKA------RKSAQPSP-----
A0A2K5F6X4_BBC3-02      -----------------------KCGVGS--------AWACP--------
A0A2K5E1W9_BMF-02       --------MEPSQCVEELEDDVFQSEDGE--------PGTQPGSL-----
A0A2K5E1W9_BMF-01       --------MEPSQCVEELEDDVFQSEDGE--------PGTQPGSL-----
A0A2K5BYA0_HRK-01       --------------MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAAR
A0A2K5CLG5_BIK-01       -------MSEVRPLSSDILMETLLCEQFVHP---------------LTME
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPGAP-TSLQ
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPGAP-TSLQ
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPGAP-TSLQ
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPGAP-TSLQ
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPGAP-TSLQ
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPGAP-TSLQ
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPGAP-TSLQ
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPGAP-TSLQ
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPGAP-TSLQ
A0A2K5CAB2_BCL2L11      ------MAKQPSDVSSECDREGRQLQPAERP------PQLRPGAP-TSLQ
A0A2K5E6K7_BAD-01       MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHPRQAPGLPGDASH
A0A2K5E6K7_BAD-03       MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHPRQAPGLPGDASH
A0A2K5E6K7_BAD-02       MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHPRQAPGLPGDASH
                                                                          

A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5F6X4_BBC3-02      -------------------------------------------------C
A0A2K5E1W9_BMF-02       -------------------------------------LSADLFAQSLLDC
A0A2K5E1W9_BMF-01       -------------------------------------LSADLFAQSLLDC
A0A2K5BYA0_HRK-01       LKALGD--------------------------------------------
A0A2K5CLG5_BIK-01       VVGGSDPEEDL---------------------------------------
A0A2K5CAB2_BCL2L11      TEPQ----------------------------------------------
A0A2K5CAB2_BCL2L11      TEPQ----------------------------------------------
A0A2K5CAB2_BCL2L11      TEPQ----------------------------------------------
A0A2K5CAB2_BCL2L11      TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSS
A0A2K5CAB2_BCL2L11      TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSS
A0A2K5CAB2_BCL2L11      TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSS
A0A2K5CAB2_BCL2L11      TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSS
A0A2K5CAB2_BCL2L11      TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSS
A0A2K5CAB2_BCL2L11      TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSS
A0A2K5CAB2_BCL2L11      TEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSS
A0A2K5E6K7_BAD-01       QQGQPTSSSHHGGAGAVETRSRH---------------------------
A0A2K5E6K7_BAD-03       QQGQPTSSSHHGGEYSTCASASS---------------------------
A0A2K5E6K7_BAD-02       QQGQPTSSSHHGGTSSPEERGHS---------------------------
                                                                          

A0A2K5CFK7_PMAIP1-      ----------------SRAPADLEVECATQ--------------------
A0A2K5F6X4_BBC3-02      QVPRASSSTWVPCQMCGPQPSLSLAEQHLE---SPVPSAPGAL-------
A0A2K5E1W9_BMF-02       PLSRLQLFPLTHC--CGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTE
A0A2K5E1W9_BMF-01       PLSRLQLFPLTHC--CGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTE
A0A2K5BYA0_HRK-01       ----------------ELHQRTMWRRRARS---RRAPAPGALPTYWPWLC
A0A2K5CLG5_BIK-01       ----------------DPVEDPLECMENSD---ALVLQLACIADQMDVSL
A0A2K5CAB2_BCL2L11      ----------------DRSPAPMSCDKSTQ---TPSPPCQAFNHYLSAMG
A0A2K5CAB2_BCL2L11      ----------------DRSPAPMSCDKSTQ---TPSPPCQAFNHYLSAMD
A0A2K5CAB2_BCL2L11      ----------------DRSPAPMSCDKSTQ---TPSPPCQAFNHYLSAMA
A0A2K5CAB2_BCL2L11      VLSRSSSGYFSFD--TDRSPAPMSCDKSTQ---TPSPPCQAFNHYLSAMV
A0A2K5CAB2_BCL2L11      VLSRSSSGYFSFD--TDRSPAPMSCDKSTQ---TPSPPCQAFNHYLSAMA
A0A2K5CAB2_BCL2L11      VLSRSSSGYFSFD--TDRSPAPMSCDKSTQ---TPSPPCQAFNHYLSAMG
A0A2K5CAB2_BCL2L11      VLSRSSSGYFSFD--TDRSPAPMSCDKSTQ---TPSPPCQAFNHYLSAMA
A0A2K5CAB2_BCL2L11      VLSRSSSGYFSFD--TDRSPAPMSCDKSTQ---TPSPPCQAFNHYLSAMA
A0A2K5CAB2_BCL2L11      VLSRSSSGYFSFD--TDRSPAPMSCDKSTQ---TPSPPCQAFNHYLSAMA
A0A2K5CAB2_BCL2L11      VLSRSSSGYFSFD--TDRSPAPMSCDKSTQ---TPSPPCQAFNHYLSAMA
A0A2K5E6K7_BAD-01       ----------------SSYPAGTEEDEGME---EEPSPFRGRSR------
A0A2K5E6K7_BAD-03       ----------------SENPSARMLSKASA---GMSAPATDSENVKLEVP
A0A2K5E6K7_BAD-02       ----------------NADAAKLQLDASHP---VLVGSELGQGRLRSLPV
                                                                          

A0A2K5CFK7_PMAIP1-      ---------------------------------------LRRFGDKLNFR
A0A2K5F6X4_BBC3-02      -----------------AGGPTQAAPGVRGEEEQWAREIGAQLRRMADDL
A0A2K5E1W9_BMF-02       EPQRLFYASAEPKSRVVAGPPL-----SAQPGFEWR--------------
A0A2K5E1W9_BMF-01       EPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCI
A0A2K5BYA0_HRK-01       AAA---------------QVAALAAWLLGRRNL-----------------
A0A2K5CLG5_BIK-01       RAR---------RLAQLYEVAMYSPGLAFILDRTDIGDVLSGIVEVFANF
A0A2K5CAB2_BCL2L11      DISLWFRFIFTFFDLYGHHHSQGTE---QLHHKYFS--------------
A0A2K5CAB2_BCL2L11      EAT---------------ESSLGIA---LRREVQWPLEWLAKSS------
A0A2K5CAB2_BCL2L11      SMR---------------QSQAEPA---GMRPEIWIAQELRRIGDEFNAY
A0A2K5CAB2_BCL2L11      REI---------------EEVVV---------------------------
A0A2K5CAB2_BCL2L11      DWD-----------------------------------------------
A0A2K5CAB2_BCL2L11      IFE-----------------------------------------------
A0A2K5CAB2_BCL2L11      SMR---------------QSQAEPA---GMRPEIWIAQELRRIGDEFNAY
A0A2K5CAB2_BCL2L11      SMR---------------QSQAEPA---GMRPEIWIAQELRRIGDEFNAY
A0A2K5CAB2_BCL2L11      SMR---------------QSQAEPA---GMRPEIWIAQELRRIGDEFNAY
A0A2K5CAB2_BCL2L11      SMR---------------QSQAEPA---GMRPEIWIAQELRRIGDEFNAY
A0A2K5E6K7_BAD-01       ---------------------SAPP---NLWAAQRYGRELRRMSDEFVDS
A0A2K5E6K7_BAD-03       CWV---------------ATAPTPQ-----------GRRRTKGWRRSPAP
A0A2K5E6K7_BAD-02       TFA---------------PHPETPPVPIALGGHLGYGRKCFLQGELTQIP
                                                                          

A0A2K5CFK7_PMAIP1-      QKLLNLISKLFCSGT------------------------------
A0A2K5F6X4_BBC3-02      NAQYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN
A0A2K5E1W9_BMF-02       ---------------REQEW---------------------GRPE
A0A2K5E1W9_BMF-01       ADQFHRLHVQQHQQNRNRVWWQVL-LFLHNLALNGEENRNGAGPR
A0A2K5BYA0_HRK-01       ---------------------------------------------
A0A2K5CLG5_BIK-01       QEDIVRLWRSLSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK-
A0A2K5CAB2_BCL2L11      ---------------------------------------------
A0A2K5CAB2_BCL2L11      ---------------------------------------------
A0A2K5CAB2_BCL2L11      YPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH---------
A0A2K5CAB2_BCL2L11      ---------------------------------------------
A0A2K5CAB2_BCL2L11      ---------------------------------------------
A0A2K5CAB2_BCL2L11      ---------------------------------------------
A0A2K5CAB2_BCL2L11      YPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH---------
A0A2K5CAB2_BCL2L11      YPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH---------
A0A2K5CAB2_BCL2L11      YPRRLEK--------------------------------------
A0A2K5CAB2_BCL2L11      YPRRISLPSD-----------------------------------
A0A2K5E6K7_BAD-01       FKGL--PRPKSAGTATQMRQSSSWTQVIQSWWDRNLGRGGSAPSQ
A0A2K5E6K7_BAD-03       FGAVRAQHPPTSGQHSAMAASSGG---------------------
A0A2K5E6K7_BAD-02       FRCV-----------------------------------------
                                                                     

© 1998-2019