Dataset for protein Bim of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5CAB2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2K5CAB2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2K5CAB2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2K5CAB2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5CAB2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5CAB2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5CAB2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5CAB2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5CAB2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5CAB2_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                        *****************************************         

A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K5CAB2_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K5CAB2_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K5CAB2_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K5CAB2_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K5CAB2_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K5CAB2_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
                                                                          

A0A2K5CAB2_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEAT---------------
A0A2K5CAB2_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGDISLWFRFIFTFFDLYGH
A0A2K5CAB2_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR---------------
A0A2K5CAB2_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR---------------
A0A2K5CAB2_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR---------------
A0A2K5CAB2_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREI---------------
A0A2K5CAB2_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE---------------
A0A2K5CAB2_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMADWD---------------
A0A2K5CAB2_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR---------------
A0A2K5CAB2_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMR---------------
                         ******************************                   

A0A2K5CAB2_BCL2L11      ESSLGIALRREVQWPLEWLAKSS---------------------------
A0A2K5CAB2_BCL2L11      HHSQGTEQLHHKYFS-----------------------------------
A0A2K5CAB2_BCL2L11      QSQAEPAGMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVI
A0A2K5CAB2_BCL2L11      QSQAEPAGMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVI
A0A2K5CAB2_BCL2L11      QSQAEPAGMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVI
A0A2K5CAB2_BCL2L11      EEVVV---------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      QSQAEPAGMRPEIWIAQELRRIGDEFNAYYPRRISLPSD-----------
A0A2K5CAB2_BCL2L11      QSQAEPAGMRPEIWIAQELRRIGDEFNAYYPRRLEK--------------
                                                                          

A0A2K5CAB2_BCL2L11      ---------------
A0A2K5CAB2_BCL2L11      ---------------
A0A2K5CAB2_BCL2L11      LRLLRYIVRLVWRMH
A0A2K5CAB2_BCL2L11      LRLLRYIVRLVWRMH
A0A2K5CAB2_BCL2L11      LRLLRYIVRLVWRMH
A0A2K5CAB2_BCL2L11      ---------------
A0A2K5CAB2_BCL2L11      ---------------
A0A2K5CAB2_BCL2L11      ---------------
A0A2K5CAB2_BCL2L11      ---------------
A0A2K5CAB2_BCL2L11      ---------------
                                       

© 1998-2018