Dataset for protein Bad of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5E6K7_BAD-01      MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHPRQAPGLPGDASH
A0A2K5E6K7_BAD-02      MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHPRQAPGLPGDASH
A0A2K5E6K7_BAD-03      MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHPRQAPGLPGDASH
                       **************************************************

A0A2K5E6K7_BAD-01      QQGQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSR--
A0A2K5E6K7_BAD-02      QQGQPTSSSHHGGTSSPEERGHSNADAAKLQLDASHPVLVGSELGQGRLR
A0A2K5E6K7_BAD-03      QQGQPTSSSHHGGEYSTCASASSSENPSARMLSKASAGMSAPATDSENVK
                       *************  :    .  .  .:    . .     ..  .  .  

A0A2K5E6K7_BAD-01      ----------SAPP---NLWAAQRYGRELRRMSDEFVDSFKGL--PRPKS
A0A2K5E6K7_BAD-02      SLPVTFAPHPETPPVPIALGGHLGYGRKCFLQGELTQIPFRCV-------
A0A2K5E6K7_BAD-03      LEVPCWVATAPTPQ-----------GRRRTKGWRRSPAPFGAVRAQHPPT
                                  :*            **           .*  :       

A0A2K5E6K7_BAD-01      AGTATQMRQSSSWTQVIQSWWDRNLGRGGSAPSQ
A0A2K5E6K7_BAD-02      ----------------------------------
A0A2K5E6K7_BAD-03      SGQHSAMAASSGG---------------------
                                                         

© 1998-2018