Dataset for protein classical BH3-containing proteins of organism Anolis carolinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H9GL49_BMF-01          MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNC
R4G9R5_BCL2L11-01      --------------------------------------------------
                                                                         

H9GL49_BMF-01          LLGRFQLFPLTHCCGPGSRQARQQDKATQTLNPSSSSQDVMLPCGVTEEP
R4G9R5_BCL2L11-01      ----------MLVVGSSQPQLCLLPKQLNVLSANAFAISCFL--------
                                     *... *     *  :.*...: : . :*        

H9GL49_BMF-01          QRLFYGNAGYRLHVSPIGFSLNPHFQEEPQESPQELRTEVQIARKLQCIA
R4G9R5_BCL2L11-01      ----YRDVPWRRTGRRWCEAETSRWQSRP--IPEDMQPEIWIAQELRRIG
                           * :. :*        : ...:*. *   *:::..*:.**.:*. *.

H9GL49_BMF-01          DQFHRLHLQRHQQNRNQVWWQIFFFLHNVALNMEANRHRAGRSCTTTYFP
R4G9R5_BCL2L11-01      DEFNASHCPRRG------------FLDYQAVNHQI---------------
                       *:*:  *  *.             **   *:* :                

H9GL49_BMF-01          FTEPPVCFPFSEMLPRFCLEAI
R4G9R5_BCL2L11-01      -----IILRLLHYIVRFIWRMQ
                            : : :   : **     

© 1998-2018