Dataset for protein classical BH3-containing proteins of organism Anabas testudineus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1ICY2_BCL2L11      MDPRQPNRSDGSTAVTATGESGGDPPPVGAAGVSTPTSRSNDGGERRFGR
A0A3Q1IPR4_BMF-01       ----------------------------------------MDDEEDDVFE
A0A3Q1K1C7_BAD-02       -------------------------------MAARFTISDSDSDPSEGME
A0A3Q1K1C7_BAD-01       -------------------------------MAARFTISDSDSDPSEGME
                                                                 *.       

A0A3Q1ICY2_BCL2L11      PDSSGGGEPESQSRCRTKSSSS--------SDGLGVFRSVFRLPRRSSSG
A0A3Q1IPR4_BMF-01       PDPHCWRTTFREIKCQDRGTQTPGPALPQNNGMLPCGVAEEPRPLFYGNA
A0A3Q1K1C7_BAD-02       EEGHNQSPPGQEQQVFPRHTLT--------------------LPELRASG
A0A3Q1K1C7_BAD-01       EEGHNQSPPGQEQQVFPRHTLT--------------------LPELRASG
                         :      .  : .   . : :                     *   ...

A0A3Q1ICY2_BCL2L11      YFSYDSDSQPSSPLSPRPVTFDRATQTPSPTGQVMNHALQRLAEANGSDL
A0A3Q1IPR4_BMF-01       GFRLHFPAHFELV-GDLEVRQQDSEEEQNGM--------------EIPP-
A0A3Q1K1C7_BAD-02       RIRLNSESHASTVYRDEELQAKADEEAGTPT--------------DGAPF
A0A3Q1K1C7_BAD-01       RIRLNSESHASTVYRDEELQAKADEEAGTPT--------------DGAPF
                         :     :: .       :  .   :  .                : .  

A0A3Q1ICY2_BCL2L11      RTHQQHGSDLSSSSTQQQNAAGDMQAVEVGRELRRIGDDFNNHLLEVAGR
A0A3Q1IPR4_BMF-01       ----RQQPLMQSVEAC------------IGQKLQLIGDQFHREHLQLYHR
A0A3Q1K1C7_BAD-02       RARSKSAPPALWAAKK------------YGQQLRRMSDEFDSLLDKGEMR
A0A3Q1K1C7_BAD-01       RARSKSAPPALWAAKK------------YGQQLRRMSDEFDSLLDKGEMR
                            .  .                     *.:*. :.*:*     :   *

A0A3Q1ICY2_BCL2L11      HRWVGIQPIRLPHIHQDPTVLLCVGLLLFVIGRIIYSQGSTNSEGHSHV
A0A3Q1IPR4_BMF-01       NQRNQGPL--------WWRLAAAMLSLLFDRGLIAGGGGAGRR------
A0A3Q1K1C7_BAD-02       KVRSAGTARQMHHSKSWW-------SYLFSHQETEGENNHHESHTHRTE
A0A3Q1K1C7_BAD-01       KVRSAGTARQMHHSKSWW-------SYLFSHQETEGENNHHESHTHRTE
                        : .                        **         .          

© 1998-2019