Dataset for protein Bad of organism Anabas testudineus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1K1C7_BAD-02      MAARFTISDSDSDPSEGMEEEGHNQSPPGQEQQVFPRHTLTLPELRASGR
A0A3Q1K1C7_BAD-01      MAARFTISDSDSDPSEGMEEEGHNQSPPGQEQQVFPRHTLTLPELRASGR
                       **************************************************

A0A3Q1K1C7_BAD-02      IRLNSESHASTVYRDEELQAKADEEAGTPTDGAPFRARSKSAPPALWAAK
A0A3Q1K1C7_BAD-01      IRLNSESHASTVYRDEELQAKADEEAGTPTDGAPFRARSKSAPPALWAAK
                       **************************************************

A0A3Q1K1C7_BAD-02      KYGQQLRRMSDEFDSLLDKGEMRKVRSAGTARQMHHSKSWWSYLFSHQET
A0A3Q1K1C7_BAD-01      KYGQQLRRMSDEFDSLLDKGEMRKVRSAGTARQMHHSKSWWSYLFSHQET
                       **************************************************

A0A3Q1K1C7_BAD-02      EGENNHHESHTHRTE
A0A3Q1K1C7_BAD-01      EGENNHHESHTHRTE
                       ***************

© 1998-2019