Dataset for protein classical BH3-containing proteins of organism Amphiprion percula

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8RLE2_BCL2L11      ----ANRTPSLVGPEQKKRNGGNLRGGGADPEPVGAAGVSAKTSRLNSTG
A0A3P8RKY9_BMF-01       ---------MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALQPNN
A0A3P8TWH6_BAD-01       MAAKFTISDSESEPSEEVEEGENNHSPATQAMPVFARRNMALPELRTPAS
                                      .:    . : .               :      . .

A0A3P8RLE2_BCL2L11      GEPDSPSWSRAQASLGVFQTRSIFHLPRRSSSGYFSADGADSVPSSPLSP
A0A3P8RKY9_BMF-01       GMLPCGVAEEPRP---LFYGNAGFRLHFPARFELIGNHQARQQGSEMEQN
A0A3P8TWH6_BAD-01       GRLRLNSESHAST---L------------SRDEELQARGEEEAGTPTDGA
                        *       . . .   :            :    :      .  :     

A0A3P8RLE2_BCL2L11      KRLTADKATQTPSPSGQVIKHALERMTDEAHGGGPGTQQHGELRLTYTRE
A0A3P8RKY9_BMF-01       GMEQLPRQQPVARSMEACIGQKLQLIGDQFH----REHLQLYHRNQRNQG
A0A3P8TWH6_BAD-01       PFRARSKSAPPALWAAKKYGQQLRRMSDEFD----SLLDKGEMKRVRSAG
                              .    .        : *  : *:          :   .   .  

A0A3P8RLE2_BCL2L11      ISCTFNLCNSFCTLFSVTVFCHLQSLFASTLQNVLIRFINPNYFSTFWKR
A0A3P8RKY9_BMF-01       PL--------WWRLAAAVLSLLFDRGFIAGGGGAGRR-------------
A0A3P8TWH6_BAD-01       TARQMHHSKSWW-------SYLFSHQEMEGENNHHESHTHRNE-------
                                  :           :.        .                 

A0A3P8RLE2_BCL2L11      C
A0A3P8RKY9_BMF-01       -
A0A3P8TWH6_BAD-01       -
                         

© 1998-2019