Dataset for protein Bad of organism Amphilophus citrinellus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q0QNQ2_BAD-01      ------FIHF------LPFIQGRGQQPSHLLQLIWGTPRHSQAIGHDQNT
A0A3Q0QNQ2_BAD-02      MPEPPRLVLFDVEEGQSPFREGSFLLLVSVISFFWSLPK-----------
                             :: *       ** :*       ::.::*. *.           

A0A3Q0QNQ2_BAD-01      SPMRHPTARRIRMNSESHTSSVSRDEELVVRGEDEICTPTEGDPFRRRSK
A0A3Q0QNQ2_BAD-02      --------------------AFSRDEELVVRGEDEICTPTEGDPFRRRSK
                                           :.****************************

A0A3Q0QNQ2_BAD-01      SAPPALWAAKKYGQQLRRMSDEFDSLLDKGMKKAKNAGTTRKMHHSKTWW
A0A3Q0QNQ2_BAD-02      SAPPALWAAKKYGQQLRRMSDEFDSLLDKGMKKAKNAGTTRKMHHSKTWW
                       **************************************************

A0A3Q0QNQ2_BAD-01      SYLFSHQESDGENSHHENHTQRTE
A0A3Q0QNQ2_BAD-02      SYLFSHQESDGENSHHENHTQRTE
                       ************************

© 1998-2019