Dataset for protein classical BH3-containing proteins of organism Ailuropoda melanoleuca

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1LIZ7_PMAIP1-01       --------------------------------------------------
G1LDR8_BCL2L11-01      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQG-------N
G1MI17_BAD-01          VGTPENPSSAPTHGPGKRKSGTDRRETRKGPRTTALAPTAQSMFQIPEFE
                                                                         

G1LIZ7_PMAIP1-01       ------------------------MPGKKARKS-----------------
G1LDR8_BCL2L11-01      PEGEGDRCPQGSPQGPLA---PPASPGPFATRSPLFI------FVRRSSL
G1MI17_BAD-01          PSEQEDSSPADRGLGPSPTGDQPPGPGKHRQTAPGLLGEAAHPQGQPASS
                                                **     :                 

G1LIZ7_PMAIP1-01       ----------------------------------------------AQAS
G1LDR8_BCL2L11-01      LSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQ
G1MI17_BAD-01          NHHGGAGAVEPRSRHSSYPAGTEEDEGLEEEELSPFR---------GRSS
                                                                      .:.

G1LIZ7_PMAIP1-01       PARTRGQPEVECAIQLRRFGDKLNFRQKLLNLISKLFRSGT---------
G1LDR8_BCL2L11-01      AVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRL
G1MI17_BAD-01          SAPPNLCAALRYGRELRRMSDEFQGSFKG---LPRPKSAGTATQMRQSPS
                       .. .   . :  . :***:.*:::        : .   : :         

G1LIZ7_PMAIP1-01       ----------------------
G1LDR8_BCL2L11-01      LRYIVRLVWRLQ----------
G1MI17_BAD-01          WTRVIQSWWDRNLGRGGSAPSQ
                                             

© 1998-2018