Dataset for protein classical BH3-containing proteins of organism Acanthochromis polyacanthus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1ELG4_BCL2L11      SSSAASPAAPHADTTEGGGADPEPVGAAGVSAK---TSRSNSTGGEPDSP
A0A3Q1FVH7_BMF-01       -----------MDDEEDDVFEPDTHCWRTTFREIKCEDRGTQTPGPALQP
A0A3Q1FVH7_BMF-02       -----------MDDEEDDVFEPDTHCWRTTFREIKCEDRGTQTPGPALQP
A0A3Q1GWH9_BAD-01       --MAAKFSISDGDSEPEEV-----------------EGENNHSPATEAMP
                                    *                        . .. : .    *

A0A3Q1ELG4_BCL2L11      SWSRASLGVFQTRSI-------FHLPRRSSSGYFSADG----------SD
A0A3Q1FVH7_BMF-01       NNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELIARQQ----------GS
A0A3Q1FVH7_BMF-02       NNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELIARQQ----------GS
A0A3Q1GWH9_BAD-01       VFARRNMALPELRTP---ASGRIRLNSESHASTLSRDEELQAKGEEEAGT
                          .    .: :           :.*   :    :: :           . 

A0A3Q1ELG4_BCL2L11      SVPSSPLSPKRLTADKTTQTPSPSGQVIRHALERMAGEAHRGGPETQRQQ
A0A3Q1FVH7_BMF-01       EMEQNGMEQLPRQQPMAHSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQ
A0A3Q1FVH7_BMF-02       EMEQNGMEQLPRQQPMAHSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQ
A0A3Q1GWH9_BAD-01       PTEGAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMKRVRSA
                              :         :  .    ** :.   : :     .      *. 

A0A3Q1ELG4_BCL2L11      HGELNDCRSCGQRKTSLTFSAVVFALAIVCPCLLSFLFTVCFRFCNKRVK
A0A3Q1FVH7_BMF-01       --------------GPL--------WWRLVAAILSLLFDGGFIAGGGGAG
A0A3Q1FVH7_BMF-02       --------------GPL--------WWRLVAAILSLLFDGGFIAGGGGAG
A0A3Q1GWH9_BAD-01       --------------GTARQMHHSKSWW-------SYLFSHQEMEGENNHH
                                       .                  * **            

A0A3Q1ELG4_BCL2L11      --------
A0A3Q1FVH7_BMF-01       RR------
A0A3Q1FVH7_BMF-02       RR------
A0A3Q1GWH9_BAD-01       ESHTHRNE
                                

© 1998-2019