Dataset for protein Bmf of organism Acanthochromis polyacanthus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1FVH7_BMF-01      MDDEEDDVFEPDTHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAE
A0A3Q1FVH7_BMF-02      MDDEEDDVFEPDTHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAE
                       **************************************************

A0A3Q1FVH7_BMF-01      EPRPLFYGNAGFRLHFPAHFELIARQQGSEMEQNGMEQLPRQQPMAHSVE
A0A3Q1FVH7_BMF-02      EPRPLFYGNAGFRLHFPAHFELIARQQGSEMEQNGMEQLPRQQPMAHSVE
                       **************************************************

A0A3Q1FVH7_BMF-01      ACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLVAAILSLLFDGGFI
A0A3Q1FVH7_BMF-02      ACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLVAAILSLLFDGGFI
                       **************************************************

A0A3Q1FVH7_BMF-01      AGGGGAGRR
A0A3Q1FVH7_BMF-02      AGGGGAGRR
                       *********

© 1998-2019